Plasmids   Select Another Resource Report Type

http://www.addgene.org/40159

Species: Caenorhabditis elegans
Genetic Insert: par-3N
Vector Backbone Description: Backbone Marker:GE; Backbone Size:4900; Vector Backbone:pGEX-6p-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pGEX6p1-par-3N Note: During the Addgene quality control process, it was determined that this construct originally encoded a par-3 fragment containing amino acid residues 1 through 408, but a premature stop codon limits the protein to amino acid residue 364.

Proper citation: RRID:Addgene_40159 Copy   

•   Source: Addgene

http://www.addgene.org/40158

Species: Caenorhabditis elegans
Genetic Insert: par-1C:FLAG
Vector Backbone Description: Backbone Marker:GE; Backbone Size:4900; Vector Backbone:pGEX-6p-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pGEX6p1-par-1C:FLAG

Proper citation: RRID:Addgene_40158 Copy   

•   Source: Addgene

http://www.addgene.org/40154

Species: Caenorhabditis elegans
Genetic Insert: par-2 RNAi resistant, S241A
Vector Backbone Description: Backbone Marker:GE; Backbone Size:4900; Vector Backbone:pGEX-6p-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pGEX6p1-par-2RR S241A

Proper citation: RRID:Addgene_40154 Copy   

•   Source: Addgene

http://www.addgene.org/40153

Species: Caenorhabditis elegans
Genetic Insert: par-2 RNAi resistant, 7SA
Vector Backbone Description: Backbone Marker:GE; Backbone Size:4900; Vector Backbone:pGEX-6p-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pGEX6p1-par-2 7SA 7SA mutations are: S190A, S197A, S241A, S265A, S295A, S301A, and S335A.

Proper citation: RRID:Addgene_40153 Copy   

•   Source: Addgene

http://www.addgene.org/40152

Species: Caenorhabditis elegans
Genetic Insert: par-2 RNAi resistant, R163A
Vector Backbone Description: Backbone Marker:GE; Backbone Size:4900; Vector Backbone:pGEX-6p-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pGEX6p1-par-2RR R163A

Proper citation: RRID:Addgene_40152 Copy   

•   Source: Addgene

http://www.addgene.org/40151

Species: Caenorhabditis elegans
Genetic Insert: par-2 RNAi resistant, K162A
Vector Backbone Description: Backbone Marker:GE; Backbone Size:4900; Vector Backbone:pGEX-6p-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pGEX6p1-par-2RR K162A

Proper citation: RRID:Addgene_40151 Copy   

•   Source: Addgene

http://www.addgene.org/40146

Species: Caenorhabditis elegans
Genetic Insert: par-2 RNAi resistant (C56S)
Vector Backbone Description: Backbone Marker:Addgene plasmid 22720; Backbone Size:18033; Vector Backbone:pID3.01; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pID3.01-par-2RR C56S

Proper citation: RRID:Addgene_40146 Copy   

•   Source: Addgene

http://www.addgene.org/40141

Species: Caenorhabditis elegans
Genetic Insert: par-2 RNAi resistant (R183-5A + 7SA)
Vector Backbone Description: Backbone Marker:Addgene plasmid 22720; Backbone Size:18033; Vector Backbone:pID3.01; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pID3.01-par-2RR R183-5A + 7SA 7SA mutations are: S190A, S197A, S241A, S265A, S295A, S301A, and S335A Note: A deletion of amino acid residues 502-523 near the C-terminus of the protein was discovered during the Addgene quality control process and is present in this plasmid.

Proper citation: RRID:Addgene_40141 Copy   

•   Source: Addgene

http://www.addgene.org/40137

Genetic Insert: par-2 RNAi resistant (wild-type)
Vector Backbone Description: Backbone Marker:Addgene plasmid 22720; Backbone Size:18033; Vector Backbone:pID3.01; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21983565
Comments: Alternate plasmid name: pID3.01-par-2RR wild-type

Proper citation: RRID:Addgene_40137 Copy   

•   Source: Addgene

http://www.addgene.org/40132

Vector Backbone Description: Backbone Marker:CLONTECH; Backbone Size:4814; Vector Backbone:pDIRECT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24747757
Comments: For more information on Pelczar TALEN Add-On Plasmids please refer to: http://www.addgene.org/TALeffector/goldengate/add-ons/#pelczar Please note that plasmid #40132 is only functional in combination with plasmid #40131.

Proper citation: RRID:Addgene_40132 Copy   

•   Source: Addgene

http://www.addgene.org/40124

Species: Homo sapiens
Genetic Insert: RINT1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:7732; Vector Backbone:pLenti6-V5/DEST; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23074196

Proper citation: RRID:Addgene_40124 Copy   

•   Source: Addgene

http://www.addgene.org/40121

Species: Caenorhabditis elegans
Genetic Insert: Mex-5 (aa244-468)
Vector Backbone Description: Backbone Marker:Addgene plasmid 17247; Backbone Size:6351; Vector Backbone:pCG150; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21925318
Comments: Dendra::MEX-5 constructs were constructed as follows. A 4.4 kb mex-5 promoter fragment based on Tenlen et al. (2008) was cloned into pDONRP4P1R (Invitrogen). Dendra2/TEV/S-peptide (Gallo et al., 2010) was cloned into pDONR201. A MEX-5 genomic fragment from the start ATG through 648 bp of 3'UTR was cloned into pDONRP2RP3. Exon 2 of mex-5 was recoded to be RNAi-resistant (Gen-Script) so as to allow depletion of endogenous MEX-5/6 without depletion of the transgene. These constructs were assembled into pCG150 using three-way Gateway system (LR reaction) (Invitrogen) (Merritt et al., 2008). Mutations were made by recombinant PCR and all inserts were sequenced verified. Alternate plasmid name: pCG150 + 4.4kb+Dendra+ gen MEX-5 aa245-STOP (RNAi res) +3’UTR

Proper citation: RRID:Addgene_40121 Copy   

•   Source: Addgene

http://www.addgene.org/40120

Species: Caenorhabditis elegans
Genetic Insert: Mex-5 (aa1-244) (RNAi resistant)
Vector Backbone Description: Backbone Marker:Addgene plasmid 17247; Backbone Size:6351; Vector Backbone:pCG150; Vector Types:Worm Expression, Gateway Cloning; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21925318
Comments: Dendra::MEX-5 constructs were constructed as follows. A 4.4 kb mex-5 promoter fragment based on Tenlen et al. (2008) was cloned into pDONRP4P1R (Invitrogen). Dendra2/TEV/S-peptide (Gallo et al., 2010) was cloned into pDONR201. A MEX-5 genomic fragment from the start ATG through 648 bp of 3'UTR was cloned into pDONRP2RP3. Exon 2 of mex-5 was recoded to be RNAi-resistant (Gen-Script) so as to allow depletion of endogenous MEX-5/6 without depletion of the transgene. These constructs were assembled into pCG150 using three-way Gateway system (LR reaction) (Invitrogen) (Merritt et al., 2008). Mutations were made by recombinant PCR and all inserts were sequenced verified. Alternate plasmid name: pCG150 + 4.4kb+Dendra+ gen MEX-5 aa1-245 (RNAi res) +3’UTR

Proper citation: RRID:Addgene_40120 Copy   

•   Source: Addgene

http://www.addgene.org/40086

Species: Caenorhabditis elegans
Genetic Insert: Mex-5 (aa 345 - 468)
Vector Backbone Description: Backbone Marker:Cheeseman lab; Backbone Size:16397; Vector Backbone:pIC26; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21925318
Comments: MEX-5 transgenes driven by the pie-1 promoter and pie-1 3'UTR were constructed by cloning the mex-5 cDNA as a SpeI fragment downstream of a Dendra2/TEV/S-peptide tag cloned into pIC26 LAP tag (Cheeseman et al., 2004). Alternate plasmid name: pIC26 Dendra + MEX-5 (aa345-STOP) (Dendra + MEX-5 ORF)

Proper citation: RRID:Addgene_40086 Copy   

•   Source: Addgene

http://www.addgene.org/40236

Species: Synthetic
Genetic Insert: LOV-ipaA
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET-21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22520757
Comments: This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide. Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine. The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector. Protein coding sequence of LOV-ipaA: MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN

Proper citation: RRID:Addgene_40236 Copy   

•   Source: Addgene

http://www.addgene.org/40235

Genetic Insert: yEGFP1
Vector Backbone Description: Backbone Size:5667; Vector Backbone:pRS413; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: yEGFP contains a M233I point mutation. Depositor states that this mutation does not affect yEGFP function.

Proper citation: RRID:Addgene_40235 Copy   

•   Source: Addgene

http://www.addgene.org/40355

Species: Mus musculus
Genetic Insert: CD40L
Vector Backbone Description: Backbone Marker:Addgene plasmid 40569; Vector Backbone:MIEG-hCD4; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19405121
Comments: The CD40-ligand (CD40L)-expressing retroviral vector was constructed by PCR amplification of cDNA from anti-CD3 activated mouse T cells with the following primers for CD40-ligand: sense 5'-CTTTCAGTCAGCATGATAGAAACA-3' and antisense 5'-TCAGAGTTTGAGTAAGCCAAAAGA-3'; these primers were used to amplify the complete coding region of mouse CD40 ligand. The CD40-ligand gene was then reamplified with primers containing XhoI and NotI sites and then cloned via XhoI and NotI sites into a retroviral vector expressing human CD4.

Proper citation: RRID:Addgene_40355 Copy   

•   Source: Addgene

http://www.addgene.org/40350

Species: Homo sapiens
Genetic Insert: Jun dominant negative
Vector Backbone Description: Backbone Marker:David A. Williams (PMID: 10961859); Vector Backbone:pMIEG3; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15699140
Comments: The Jun dominant negative vector was made by first preparing a version of c-Jun with the first 122 aa deleted. This cDNA was amplified by PCR from human c-Jun with the following primers: sense, 5-AAAAAA-GAATTC-ATGACTAGCCAGAACACGCTGCCCAGCGTC-3; antisense, 5-AAAAAA-GAATTC-TCAGCTGGCATAGTCAGGCACGTCATAAGGATAGCTAAATGTTTGCAAC-3. The antisense primer adds a hemagglutinin tag to the C terminus of c-Jun. The PCR product was then cut with EcoRI and cloned into the retroviral vector pMIEG3.

Proper citation: RRID:Addgene_40350 Copy   

•   Source: Addgene

http://www.addgene.org/40346

Species: Homo sapiens
Genetic Insert: BCL6
Vector Backbone Description: Backbone Marker:Niwa, Yamamura, and Miyazaki (PMID: 1660837); Backbone Size:5200; Vector Backbone:pCXN2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12165517
Comments: CXN-BCL-6 was constructed by inserting the human BCL-6 cDNA from pBS-BCL-6 full length (FL) via SalI ends into the XhoI site in the pCXN2 expression vector. The pCXN2 (CXN) vector was obtained from Dr. K. Ozato (National Institute of Child Health and Human Development, National Institutes of Health, Bethesda, MD) and consists of the human BCL-6 cDNA driven by a hybrid
β-actin-CMV promoter.

Proper citation: RRID:Addgene_40346 Copy   

•   Source: Addgene

http://www.addgene.org/40344

Species: Homo sapiens
Genetic Insert: RASSF6
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pCI-neo (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19797269
Comments: pCIneoFH vector has the sequence NheI-FLAG-His6-EcoRI-MluI-XbaI-SalI-SmaI-NotI. A digest with NheI and SalI will excise the insert with tags.

Proper citation: RRID:Addgene_40344 Copy   

•   Source: Addgene