Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: Ataxin-1
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA1.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9353120
Proper citation: RRID:Addgene_33235 Copy
Species: Drosophila melanogaster
Genetic Insert: Cyc
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His A; Vector Types:Insect Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18494558
Proper citation: RRID:Addgene_33156 Copy
Species: Drosophila melanogaster
Genetic Insert: CLK
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His B; Vector Types:Insect Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11158307
Proper citation: RRID:Addgene_33153 Copy
Species: Orthoreovirus T3D
Genetic Insert: L2
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20042210
Proper citation: RRID:Addgene_33300 Copy
Species: Orthoreovirus T1L
Genetic Insert: L1
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20042210
Proper citation: RRID:Addgene_33303 Copy
Species: Orthoreovirus T1L
Genetic Insert: L2
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20042210
Proper citation: RRID:Addgene_33304 Copy
Species: Orthoreovirus T3D
Genetic Insert: S2
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20042210
Proper citation: RRID:Addgene_33302 Copy
Species: uncultured proteobacterium EBAC31A08
Genetic Insert: Proteorhodopsin Optical Proton Sensor
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4127; Vector Backbone:pBAD TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21764748
Proper citation: RRID:Addgene_33780 Copy
Species: firefly
Genetic Insert: Firefly Luciferase
Vector Backbone Description: Backbone Marker:David Baltimore; Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21439256
Proper citation: RRID:Addgene_33307 Copy
Genetic Insert: HSV-TK/GFP
Vector Backbone Description: Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19114988
Proper citation: RRID:Addgene_33308 Copy
Species: Mus musculus
Genetic Insert: CREB
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9447994
Comments: A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.
Proper citation: RRID:Addgene_33371 Copy
Species: Homo sapiens
Genetic Insert: TCPTP-45
Vector Backbone Description: Backbone Marker:Vanberbilt structural biology core plasmid; Vector Backbone:pBG100; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:20940300
Proper citation: RRID:Addgene_33365 Copy
Species: Homo sapiens
Genetic Insert: TCPTP-45
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pIRESpuro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20940300
Proper citation: RRID:Addgene_33366 Copy
Species: Mus musculus
Genetic Insert: Cebpb
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: This is the dominant negative Cebpb- which contains an N-terminal acidic extension (LEQRAEELARENEELEKEAEELEQENAE) fused to the HLH-ZIP region of Cebpb.
Proper citation: RRID:Addgene_33363 Copy
Species: Homo sapiens
Genetic Insert: Cav1
Vector Backbone Description: Backbone Marker:GE Healthcare; Vector Backbone:pGEX-6p; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20940300
Proper citation: RRID:Addgene_33364 Copy
Species: Mus musculus
Genetic Insert: ATF
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: This is the dominant negative ATF- which contains an N-terminal acidic extension fused to the HLH-ZIP region of ATF.
Proper citation: RRID:Addgene_33362 Copy
Species: Homo sapiens
Genetic Insert: Scambio
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:5300; Vector Backbone:pIRESNEO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15107133
Proper citation: RRID:Addgene_33354 Copy
Species: Mus musculus
Genetic Insert: FOS
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9447994
Comments: Acidic amphipathic extension added to the Fos leucine zipper: LEQRAEELARENEELEKEAEELEQELAE
Although the acidic extension is to the c-Fos leucine zipper, A-Fos heterodimerizes and inhibits c-Jun.
Proper citation: RRID:Addgene_33353 Copy
Species: Cricetulus griseus (hamster)
Genetic Insert: SREBP2
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:14702347
Comments: This is the dominant negative SREBP2- which contains an N-terminal acidic extension fused to the HLH-ZIP region of SREBP2.
Proper citation: RRID:Addgene_33358 Copy
Genetic Insert: TetR cassette
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pCRII; Vector Types:Mouse Targeting; Bacterial Resistance:Ampicillin
Comments: Do not select for this plasmid with tetracycline, as we have found that the Tet resistance cassette does not work reliably in high-copy plasmids such as this one. The Tet cassette MUST be transferred to a low-copy vector, e.g. a BAC, to allow Tet resistance in a reliable fashion. In BAC clones the Tet cassette has been extremely reliable.
Proper citation: RRID:Addgene_33359 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
