Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
On page 137 showing 2721 ~ 2740 out of 12,959 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

    • RRID:Addgene_33006

    This resource has 1+ mentions.

http://www.addgene.org/33006

Species: Mus musculus
Genetic Insert: hepatic nuclear factor 4 alpha
Vector Backbone Description: Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21716291

Proper citation: RRID:Addgene_33006 Copy   

    • RRID:Addgene_32950

http://www.addgene.org/32950

Species: Mus musculus
Genetic Insert: Slc9a3R1
Vector Backbone Description: Backbone Marker:stratagene; Backbone Size:2960; Vector Backbone:pBluescript SK1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10500246
Comments: original clone from Stratagene's Mouse kidney cDNA library "UniZap" XR vector Cat # 93715

Proper citation: RRID:Addgene_32950 Copy   

    • RRID:Addgene_33008

    This resource has 1+ mentions.

http://www.addgene.org/33008

Species: Mus musculus
Genetic Insert: forkhead box A2
Vector Backbone Description: Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21716291

Proper citation: RRID:Addgene_33008 Copy   

    • RRID:Addgene_32928

    This resource has 1+ mentions.

http://www.addgene.org/32928

Species: Mus musculus
Genetic Insert: Ngn2
Vector Backbone Description: Backbone Size:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21852222

Proper citation: RRID:Addgene_32928 Copy   

    • RRID:Addgene_32929

    This resource has 1+ mentions.

http://www.addgene.org/32929

Species: Mus musculus
Genetic Insert: Isl1
Vector Backbone Description: Backbone Size:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21852222

Proper citation: RRID:Addgene_32929 Copy   

    • RRID:Addgene_32927

    This resource has 1+ mentions.

http://www.addgene.org/32927

Species: Mus musculus
Genetic Insert: Lhx3
Vector Backbone Description: Backbone Size:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21852222

Proper citation: RRID:Addgene_32927 Copy   

    • RRID:Addgene_32925

    This resource has 1+ mentions.

http://www.addgene.org/32925

Species: Mus musculus
Genetic Insert: Brn2
Vector Backbone Description: Backbone Marker:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21852222

Proper citation: RRID:Addgene_32925 Copy   

    • RRID:Addgene_32980

    This resource has 1+ mentions.

http://www.addgene.org/32980

Species: Mus musculus
Genetic Insert: Mcl-1
Vector Backbone Description: Backbone Size:6295; Vector Backbone:pMSCVpuro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20385764

Proper citation: RRID:Addgene_32980 Copy   

    • RRID:Addgene_32982

    This resource has 1+ mentions.

http://www.addgene.org/32982

Species: Mus musculus
Genetic Insert: Mcl-1
Vector Backbone Description: Backbone Size:6295; Vector Backbone:pMSCVpuro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20385764

Proper citation: RRID:Addgene_32982 Copy   

    • RRID:Addgene_32986

http://www.addgene.org/32986

Species: Mus musculus
Genetic Insert: Mcl-1
Vector Backbone Description: Backbone Marker:Invivogen; Backbone Size:4470; Vector Backbone:pBroad3-MCS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20385764

Proper citation: RRID:Addgene_32986 Copy   

    • RRID:Addgene_33123

http://www.addgene.org/33123

Species: Mus musculus
Genetic Insert: Pcdh-γA3
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21917590

Proper citation: RRID:Addgene_33123 Copy   

    • RRID:Addgene_33122

http://www.addgene.org/33122

Species: Mus musculus
Genetic Insert: Pcdh-γA3
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21917590

Proper citation: RRID:Addgene_33122 Copy   

    • RRID:Addgene_33113

http://www.addgene.org/33113

Species: Mus musculus
Genetic Insert: Pcdh-γA3
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21917590

Proper citation: RRID:Addgene_33113 Copy   

    • RRID:Addgene_33114

http://www.addgene.org/33114

Species: Mus musculus
Genetic Insert: Pcdh-γA3
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21917590

Proper citation: RRID:Addgene_33114 Copy   

http://www.addgene.org/33249

Species: Mus musculus
Genetic Insert: FGFR2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10851026

Proper citation: RRID:Addgene_33249 Copy   

    • RRID:Addgene_33273

http://www.addgene.org/33273

Species: Mus musculus
Genetic Insert: GLIS1, Gateway casette A
Vector Backbone Description: Backbone Marker:Dr. Toshio Kitamura; Backbone Size:4700; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21654807

Proper citation: RRID:Addgene_33273 Copy   

    • RRID:Addgene_33374

http://www.addgene.org/33374

Species: Mus musculus
Genetic Insert: Etv3
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18025162

Proper citation: RRID:Addgene_33374 Copy   

    • RRID:Addgene_33375

http://www.addgene.org/33375

Species: Mus musculus
Genetic Insert: Etv3
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18025162

Proper citation: RRID:Addgene_33375 Copy   

    • RRID:Addgene_33371

    This resource has 1+ mentions.

http://www.addgene.org/33371

Species: Mus musculus
Genetic Insert: CREB
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9447994
Comments: A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.

Proper citation: RRID:Addgene_33371 Copy   

    • RRID:Addgene_33363

    This resource has 1+ mentions.

http://www.addgene.org/33363

Species: Mus musculus
Genetic Insert: Cebpb
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: This is the dominant negative Cebpb- which contains an N-terminal acidic extension (LEQRAEELARENEELEKEAEELEQENAE) fused to the HLH-ZIP region of Cebpb.

Proper citation: RRID:Addgene_33363 Copy   

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch