Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pGCDNsam-Hnf4a-IRES-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33006 | hepatic nuclear factor 4 alpha | Mus musculus | Ampicillin | PMID:21716291 | Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 3 | ||
|
Mouse NHERF-1 Resource Report Resource Website |
RRID:Addgene_32950 | Slc9a3R1 | Mus musculus | Ampicillin | PMID:10500246 | original clone from Stratagene's Mouse kidney cDNA library "UniZap" XR vector Cat # 93715 | Backbone Marker:stratagene; Backbone Size:2960; Vector Backbone:pBluescript SK1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | none | 2026-08-15 01:13:45 | 0 |
|
pGCDNsam-Foxa2-IRES-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33008 | forkhead box A2 | Mus musculus | Ampicillin | PMID:21716291 | Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:51 | 1 | ||
|
pMXs-Ngn2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32928 | Ngn2 | Mus musculus | Ampicillin | PMID:21852222 | Backbone Size:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:50 | 1 | ||
|
pMXs-Isl1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32929 | Isl1 | Mus musculus | Ampicillin | PMID:21852222 | Backbone Size:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 3 | ||
|
pMXs-Lhx3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32927 | Lhx3 | Mus musculus | Ampicillin | PMID:21852222 | Backbone Size:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 1 | ||
|
pMXs-Brn2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32925 | Brn2 | Mus musculus | Ampicillin | PMID:21852222 | Backbone Marker:4800; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:50 | 1 | ||
|
pMSCV-puro-mMcl-1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32980 | Mcl-1 | Mus musculus | Ampicillin | PMID:20385764 | Backbone Size:6295; Vector Backbone:pMSCVpuro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 2 | ||
|
pMSCV-puro-Flag-mMcl-1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32982 | Mcl-1 | Mus musculus | Ampicillin | PMID:20385764 | Backbone Size:6295; Vector Backbone:pMSCVpuro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 1 | ||
|
pBROAD3-Flag-mMcl-1 Resource Report Resource Website |
RRID:Addgene_32986 | Mcl-1 | Mus musculus | Ampicillin | PMID:20385764 | Backbone Marker:Invivogen; Backbone Size:4470; Vector Backbone:pBroad3-MCS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 0 | ||
|
VCDstubΔ741-752-GFP Resource Report Resource Website |
RRID:Addgene_33123 | Pcdh-γA3 | Mus musculus | Kanamycin | PMID:21917590 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Contains a signal sequence fused to a very small extracellular domain fragment and no constant domain and deletion of aa 741-752 | 2026-08-15 01:13:46 | 0 | |
|
VCDstub-GFP Resource Report Resource Website |
RRID:Addgene_33122 | Pcdh-γA3 | Mus musculus | Kanamycin | PMID:21917590 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Contains a signal sequence fused to a very small extracellular domain fragment and no constant domain | 2026-08-15 01:13:52 | 0 | |
|
γA3/N-GFP Resource Report Resource Website |
RRID:Addgene_33113 | Pcdh-γA3 | Mus musculus | Kanamycin | PMID:21917590 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Cytoplasmic domain has been replaced with the N-cadherin cytoplasmic domain | 2026-08-15 01:13:46 | 0 | |
|
Δconst-GFP Resource Report Resource Website |
RRID:Addgene_33114 | Pcdh-γA3 | Mus musculus | Kanamycin | PMID:21917590 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Deletion of the C-terminal constant region (amino acids 805-928) | 2026-08-15 01:13:52 | 0 | |
|
pcDNA3.1/FGFR2-S252W(Apert) myc Resource Report Resource Website |
RRID:Addgene_33249 | FGFR2 | Mus musculus | Ampicillin | PMID:10851026 | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Mutation S252W in FGFR2 found in Apert syndrome. cDNA is a 3-Ig domain (IIIC) isoform of FGFR2. KpnI site introduced at stop codon to be inframe with myc-his tag from pcDNA vector | 2026-08-15 01:13:48 | 0 | |
|
pMXs-mGLIS1 Resource Report Resource Website |
RRID:Addgene_33273 | GLIS1, Gateway casette A | Mus musculus | Ampicillin | PMID:21654807 | Backbone Marker:Dr. Toshio Kitamura; Backbone Size:4700; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:54 | 0 | ||
|
pcDNA3.1-mETV3 Resource Report Resource Website |
RRID:Addgene_33374 | Etv3 | Mus musculus | Ampicillin | PMID:18025162 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:49 | 0 | ||
|
pcDNA3.1-mETV3-HA Resource Report Resource Website |
RRID:Addgene_33375 | Etv3 | Mus musculus | Ampicillin | PMID:18025162 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:55 | 0 | ||
|
CMV500 A-CREB Resource Report Resource Website 1+ mentions |
RRID:Addgene_33371 | CREB | Mus musculus | Ampicillin | PMID:9447994 | A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see notes) | 2026-08-15 01:13:49 | 5 |
|
CMV500 A-C/EBPβ Resource Report Resource Website 1+ mentions |
RRID:Addgene_33363 | Cebpb | Mus musculus | Ampicillin | This is the dominant negative Cebpb- which contains an N-terminal acidic extension (LEQRAEELARENEELEKEAEELEQENAE) fused to the HLH-ZIP region of Cebpb. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see comments) | 2026-08-15 01:13:49 | 3 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
