Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:synthetic (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

30,421 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pCMV-H-RAN-H2A2B
 
Resource Report
Resource Website 		RRID:Addgene_106419 H-RAN-H2A2B Synthetic Kanamycin PMID:29440485 It contains a sequence from Addgene #59759. Backbone Marker:Takara/Clontech; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:01 0
pQZ210
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_106414 Rat Synaptobrevin-2 fragment 28-66 Synthetic Chloramphenicol PMID:28813412 Backbone Marker:Novagen; Vector Backbone:pACYCDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol Fragment 28-66, Codon optimization 2026-08-15 01:01:06 1
hygII-UT-ABAleon2.15
 
Resource Report
Resource Website 		RRID:Addgene_106983 ABAleon2.1 Synthetic Kanamycin PMID:24737861 Vector Backbone:hygII-UT; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:08 0
barII-UT-ABAleon2.1
 
Resource Report
Resource Website 		RRID:Addgene_106981 ABAleon2.1 Synthetic Kanamycin PMID:24737861 Vector Backbone:barII-UT; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:05 0
CROPseq-EFS-HypaSpCas9-P2A-EGFP
 
Resource Report
Resource Website 		RRID:Addgene_106964 HypaSpCas9 Synthetic Ampicillin Backbone Size:9492; Vector Backbone:CROPseq-Guide-EFS-SpCas9-P2A-EGFP; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:05 0
pX601-miniCMV-SaCas9-U6-YFPvsSaCas9 sgRNA
 
Resource Report
Resource Website 		RRID:Addgene_107050 SaCas9 Synthetic Ampicillin YFP sgRNA for SaCas9 Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pX601-miniCMV-SaCas9-U6-LacZvsSaCas9 sgRNA
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107049 SaCas9 Synthetic Ampicillin LacZ sgRNA for SaCas9 Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 1
pET21d-colEdes12/Imdes12
 
Resource Report
Resource Website 		RRID:Addgene_107120 colEdes12/Imdes12 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes12: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKKKFWKEVSKDPDLSKQFKGSNRENIKQGIAPFARQKDQVGGRRVFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes12: MELKHSISDYTEAEFLEFVKEICQKNSAGELDESLFKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-M1C
 
Resource Report
Resource Website 		RRID:Addgene_107085 M. sedula PCNA1 fused to CyPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-YS3
 
Resource Report
Resource Website 		RRID:Addgene_107084 S. solfataricus PCNA3 fused to YPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-YS1
 
Resource Report
Resource Website 		RRID:Addgene_107082 S. solfataricus PCNA1 fused to YPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 0
pET15b-YM2
 
Resource Report
Resource Website 		RRID:Addgene_107080 M. sedula PCNA2 fused to YPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes6/Imdes6
 
Resource Report
Resource Website 		RRID:Addgene_107114 colEdes6/Imdes6 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes6: MESKRNKPGKATGKGKPVGDRWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLAKQFNRANREHIKQGQAPFAPKKNQVGGRQTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes6: MELKHSISDYTEAEFLEFVKKIFSQGRLEETRPLVEEFERLTEHPDGSDLVYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes5/Imdes5
 
Resource Report
Resource Website 		RRID:Addgene_107113 colEdes5/Imdes5 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes5: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKKKFWKEVAKDPDLSKQFKGSNQKNIKNGQAPFARQKDQVGGRRRFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes5: MELKHSISDYTEAEFLEFVKKICNTDNENVQFKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 0
pET15b-YM1
 
Resource Report
Resource Website 		RRID:Addgene_107079 M. sedula PCNA1 fused to YPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes4/Imdes4
 
Resource Report
Resource Website 		RRID:Addgene_107112 colEdes4/Imdes4 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes4: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKRANKDSISKGQAPFARKKDQVGGRKTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes4: MELKHSISDYTEAEFLEFVKKILQASSGGGGNEDLSRKLVEEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes10/Imdes10
 
Resource Report
Resource Website 		RRID:Addgene_107118 colEdes10/Imdes10 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes10: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKGANQDSIKQGQAPFARSKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes10: MELKHSISDYTEAEFLEFVKKIIATNDETQQRALVDEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-S3C
 
Resource Report
Resource Website 		RRID:Addgene_107090 S. solfataricus PCNA3 fused to CyPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes17/Imdes17
 
Resource Report
Resource Website 		RRID:Addgene_107125 colEdes17/Imdes17 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes17: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLAKQFKRSNRDRIKQGQAPFAPQKDQVGGRKTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes17: MELKHSISDYTEAEFLEFVKKICKADEEQARQLVEEFIRLTEHPSGSDLVYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes15/Imdes15
 
Resource Report
Resource Website 		RRID:Addgene_107123 colEdes15/Imdes15 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes15: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKGANQRNIKQGQAPFAPKKDQVGGRKTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes15: MELKHSISDYTEAEFLEFVKEILEIQDEELQKIQVEEFERLTEHPDGSDLIYYPRDDRDDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch