Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 16 showing 301 ~ 320 out of 566 results
Snippet view Table view Download 566 Result(s)
Click the to add this resource to a Collection
  • RRID:Addgene_117086

http://www.addgene.org/117086

Species: Arabidopsis thaliana
Genetic Insert: AtFRD3
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117086 Copy   


  • RRID:Addgene_117104

http://www.addgene.org/117104

Species: Arabidopsis thaliana
Genetic Insert: SLAH2
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117104 Copy   


  • RRID:Addgene_117101

http://www.addgene.org/117101

Species: Arabidopsis thaliana
Genetic Insert: SLAC1-deltaN
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117101 Copy   


http://www.addgene.org/117664

Species: Other
Genetic Insert: pre-pro-alphaf-Btl2
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.

Proper citation: RRID:Addgene_117664 Copy   


http://www.addgene.org/117658

Species: Other
Genetic Insert: pre-pro-alphaf-E2-Crimson
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.

Proper citation: RRID:Addgene_117658 Copy   


  • RRID:Addgene_117886

http://www.addgene.org/117886

Species: Arabidopsis thaliana
Genetic Insert: AtALMT1-uPIC 5'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117886 Copy   


  • RRID:Addgene_117882

http://www.addgene.org/117882

Species: Arabidopsis thaliana
Genetic Insert: CHL1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117882 Copy   


  • RRID:Addgene_117881

http://www.addgene.org/117881

Species: Arabidopsis thaliana
Genetic Insert: CHL1 P492L
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117881 Copy   


  • RRID:Addgene_117888

http://www.addgene.org/117888

Species: Arabidopsis thaliana
Genetic Insert: AtALMT1-uPIC 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MLLASNFDTLSHFLQDFGDEYFEAREKGDYKVVEKRKKNLERYKSVLDSKSDEEALANYAEWEPPHGQFRFRHPWKQYVAVGALLRQCAYRIDALNSYINSDFQIPVDIKKKLETPLRRMSSESGNSMKEMSISLKQMIKSSSSDIHVSNSQAACKSLSTLLKSGILNDVEPLQMISLMTTVSMLIDIVNLTEKISESVHELASAARFKNKMRPTVLYEKSDSGSIGRAMPIDSHEDHHVVTVLHDVDNDRSNNVDDSRGGSSQDSCHHVAIKIVDDNSNHEKHEDGEIHVHTLSNGHLQALNLSSGENLYFQSVDHHHHHH-

Proper citation: RRID:Addgene_117888 Copy   


  • RRID:Addgene_117873

http://www.addgene.org/117873

Species: Zea mays
Genetic Insert: Mito Carr 2
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MSSSQESTFTSASAAAQVNASALDLLPVYAKELIAGGAAGAFAKTAVAPLERVKILLQTRTEGFQSLGILQSLRKLWQYEGIRGFYKGNGASVLRIVPYAALHYMTYEQYRCWILNNSASSIGTGPVVDLLAGSAAGGTAVLCTYPLDLARTKLAYQVSNVGQTGNALGNSGQQQTYNGIKDVFKTVYKEGGARSLYRGVGPTLIGILPYAGLKFYIYEDLKSQVPDDYKDSVILKLSCGALAGLFGQTLTYPLDVVRRQMQVQSKQSQNSSDGFRIRGTFQGLLLIIRCQGWRQLFAGLSLNYVKVVPSVAIGFTTYDMMKALLGVPPRERVHASGGNK

Proper citation: RRID:Addgene_117873 Copy   


  • RRID:Addgene_117875

http://www.addgene.org/117875

Species: Arabidopsis thaliana
Genetic Insert: CHL1 wt
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117875 Copy   


  • RRID:Addgene_117871

http://www.addgene.org/117871

Species: Triticum aestivum
Genetic Insert: TaALMT-upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117871 Copy   


  • RRID:Addgene_117870

http://www.addgene.org/117870

Species: Triticum aestivum
Genetic Insert: TaALMT-uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117870 Copy   


  • RRID:Addgene_117876

http://www.addgene.org/117876

Species: Arabidopsis thaliana
Genetic Insert: CHL1 wt-eGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117876 Copy   


  • RRID:Addgene_117879

http://www.addgene.org/117879

Species: Arabidopsis thaliana
Genetic Insert: CHL1 T101D
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117879 Copy   


  • RRID:Addgene_117864

http://www.addgene.org/117864

Species: Zea mays
Genetic Insert: ZmNRAT-uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MEQAGDETPGEIGREAARREAALRSGGGDAGERVDKAVVDGGEDERFRVQRKWRRFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYQLLWVILVGMVFALLIQTLAANLGVKTGKHLAELCREEYPRSVNICLWIIAEMAVISDDIPEVLGTAFAFNILLGIPLWAGVVLTVLSTLLLLGVQRFGARKLEFVVAAFMFAMAACFFGELSYLRPSAGEVVEGMFVPRLRGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSVKSIRAACRYFLVECSLAFVVAFLINVAVVVVAGSICNAAGGNLSPADAAACGDLTLQSTPLLLRDVLGRSSSVVYAVALLASGQSTTISCTFAGQVIMQGFLDMRMKSWVRNLTTRAIAIAPSLVVSIVSGPSGAGKLIVFSSMVLSFELPFALIPLLKFCNSSNKVGPLKESIYTVVIAWALSFALIVVNTYFLVWTYVDWLVHSRLPKYATALLSVAVLALMAAYLAFVVYLAFRRDAVRTYVPVSERAEDGSGSQAVAAAASADDADMPAPFRKDLADASTE

Proper citation: RRID:Addgene_117864 Copy   


  • RRID:Addgene_117869

http://www.addgene.org/117869

Species: Arabidopsis thaliana
Genetic Insert: CBL5-upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117869 Copy   


  • RRID:Addgene_117902

http://www.addgene.org/117902

Species: Arabidopsis thaliana
Genetic Insert: AtCOPT6 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDEKPFEQLENLYQSHHHHHH

Proper citation: RRID:Addgene_117902 Copy   


  • RRID:Addgene_117867

http://www.addgene.org/117867

Species: Oryza sativa
Genetic Insert: OsNRAT-upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117867 Copy   


  • RRID:Addgene_117859

http://www.addgene.org/117859

Species: Oryza sativa
Genetic Insert: OsKEA3
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDYKDDDDKSASSAEGRGRRRWWRRGRRALRVRAAAGMDIASAVEVINDLGFDTLTFLGVTVLVVPAFRVVKASPILGFFCAGVVLNQFGLIRNLTDVKLLSEWGILFLLFEMGLELSLSRLKALARYAFGMGLPQVLLSTLAFTAFELPPNGAIGTKILQFLFDSRPDLVNIRSVDEAIVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDIAVVPLLVILPVLESQNVVEQSVWPMLLAESLKALGGLGLLSLGGKYLIRRIFEFVAESRSSEAFVALCLLTVSGTSLLTQWLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFVTTGTSIDMELLIREWPNVLSLLGGLIAIKTLIITAIGPRVGLTLQESVRIGLLLSQGGEFGFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPLLNEIGRRAAGIIDEKSETKEKPAEMVNYDATEPIVILGFGEMGKVLAKFLSAPLSFGLDKDAEGWPYVAFDLNPAVVKSARKSGFPVLYGDGSRPLVLQSAGVSSPKAVMVMYTGKEKTIEAVNRLRQAFPGVPMYARAQDMSHLLDLKKAGATEVVLENAETSLQLGSMLLRGLGVMSDDVSFFSKLVRDSMELQAQEALNNIENREIDIMKPLEIRISDLVERNGNGSRMIAQEDSLRLSSRPNIPLIEATLEDRIPETTGENDQTGYDFNNIDSEDGVKYCLLEASDDESEASNSSKEMIDQSVGTRGSHHHHHHHHHH*

Proper citation: RRID:Addgene_117859 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X