Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: AtPQL upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MIRDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYTAVLYTLATLVLYVQSIYYGHIYPRLMKNRRNHQMVDVEEPLLREEAKRPSTKSLLCVVSVFLFLGSFNVLSGSRSMDLRGKDRVFVVGGAGARKLLEVSSGNLGENNNIGMWLGWAMAAIYMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVNSVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYFHCRKVEADSVKKKHETGEEAVENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117897 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtPQL uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MIRDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYTAVLYTLATLVLYVQSIYYGHIYPRLMKNRRNHQMVDVEEPLLREEAKRPSTKSLLCVVSVFLFLGSFNVLSGSRSMDLRGKDRVFVVGGAGARKLLEVSSGNLGENNNIGMWLGWAMAAIYMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVNSVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYFHCRKVEADSVKKKHETGEEAVENLYQSHHHHHH
Proper citation: RRID:Addgene_117896 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-upGFP 5'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117891 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-uPIC 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117892 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT6 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDEKPFEQLENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117903 Copy
Species: Oryza sativa
Genetic Insert: OsSLAC1 eGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTLEGSENLYFQSGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHHHH
Proper citation: RRID:Addgene_117905 Copy
Species: Other
Genetic Insert: ccdB
Vector Backbone Description: Vector Backbone:pDONR-P2R-P3z; Vector Types:Unspecified; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Comments: Addgene NGS identified an in-frame insertion in the ccdB gene in this plasmid, the depositing lab confirmed that this variant was present in their initial stock of the plasmid and has functioned as expected.
Proper citation: RRID:Addgene_118389 Copy
Species: Other
Genetic Insert: AtMIR390a backbone
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:RNAi; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118388 Copy
Species: Other
Genetic Insert: dCAS9p
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118387 Copy
Species: Other
Genetic Insert: AtU3b promoter
Vector Backbone Description: Vector Backbone:pDONR-P2R-P3z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118390 Copy
Species: Homo sapiens
Genetic Insert: KCNK4
Vector Backbone Description: Vector Backbone:pPICZ; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:25500157
Proper citation: RRID:Addgene_130670 Copy
Species: Synthetic
Genetic Insert: AausFP1
Vector Backbone Description: Backbone Marker:Green lab; Backbone Size:2284; Vector Backbone:Z1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:42490567
Proper citation: RRID:Addgene_135047 Copy
Species: Synthetic
Genetic Insert: AausFP1
Vector Backbone Description: Backbone Size:2225; Vector Backbone:EF1a-AausFP1-Z1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:42490567
Proper citation: RRID:Addgene_135048 Copy
Species: Synthetic
Genetic Insert: eGFP
Vector Backbone Description: Backbone Marker:Green Lab; Backbone Size:2226; Vector Backbone:Z1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:42490567
Proper citation: RRID:Addgene_135049 Copy
Species: Synthetic
Genetic Insert: mNeonGreen
Vector Backbone Description: Backbone Marker:Green Lab; Backbone Size:2150; Vector Backbone:Z1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:42490567
Proper citation: RRID:Addgene_135613 Copy
Species: Synthetic
Genetic Insert: AausFP1
Vector Backbone Description: Backbone Marker:Green Lab; Backbone Size:2148; Vector Backbone:Z1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:42490567
Proper citation: RRID:Addgene_135614 Copy
Species: Mus musculus
Genetic Insert: Potassium channel subfamily K member 2 (KCNK2, TREK-1)
Vector Backbone Description: Vector Backbone:pPICZ; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:28693035
Proper citation: RRID:Addgene_133269 Copy
Species: Mus musculus
Genetic Insert: IgG2b heavy chain
Vector Backbone Description: Backbone Marker:Invivogen; Backbone Size:4489; Vector Backbone:pFUSEss-CHIg-mG2a; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:29875771
Proper citation: RRID:Addgene_105930 Copy
Species: Mus musculus
Genetic Insert: IgG2b
Vector Backbone Description: Backbone Marker:Invivogen; Backbone Size:4517; Vector Backbone:pFUSEss-CHIg-mG2b; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:29875771
Proper citation: RRID:Addgene_105931 Copy
Species: Mus musculus
Genetic Insert: IgG1, IgG3
Vector Backbone Description: Backbone Marker:Invivogen; Backbone Size:4477; Vector Backbone:pFUSEss-CHIg-mG3 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:29875771
Proper citation: RRID:Addgene_105859 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
