Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
Intersectin SH3 domain A Resource Report Resource Website |
RRID:Addgene_47396 | Intersectin SH3 domain A | Other | Ampicillin | PMID:9813051 | Backbone Marker:Amersham; Backbone Size:5000; Vector Backbone:pGEX-2t; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | SH3 domain A | 2026-08-15 01:15:42 | 0 | |
|
pDD122 (Peft-3::Cas9 + ttTi5605 sgRNA) Resource Report Resource Website 1+ mentions |
RRID:Addgene_47550 | Cas9 | Synthetic | Ampicillin | PMID:23995389 | For more information on Goldstein Lab CRISPR Plasmids please refer to: http://www.addgene.org/crispr/Goldstein/ gRNA target sequence atatcagtctgtttcgtaa Please note: eft-3 has officially been changed to eef-1A.1 Please see the eef-1A.1 WormBase entry for details: http://www.wormbase.org/species/c_elegans/gene/WBGene00001168#05-9g-3 | Backbone Size:2300; Vector Backbone:pCFJ601; Vector Types:Worm Expression, CRISPR; Bacterial Resistance:Ampicillin | Codon optimized and with synthetic introns for C. elegans | 2026-08-15 01:15:43 | 9 |
|
Nanog-2A-mCherry Resource Report Resource Website 1+ mentions |
RRID:Addgene_48680 | Nanog | Mus musculus | Ampicillin | PMID:23992847 | Vector Backbone:pCR2.1TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 1 | ||
|
pTYB1-pLAC-N45 Resource Report Resource Website |
RRID:Addgene_48718 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Deleted first 45 amino acids of mature lacritin without signal peptide | 2026-08-15 01:15:53 | 0 |
|
pLJM60 mUlk1 (wt) barcoded Resource Report Resource Website |
RRID:Addgene_48799 | ULK1 | Mus musculus | Ampicillin | PMID:23888043 | Backbone Marker:Sabatini lab; Backbone Size:7400; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 0 | ||
|
pcDNA3.1-Myc-14-3-3ζ Resource Report Resource Website 1+ mentions |
RRID:Addgene_48798 | YWHAZ | Homo sapiens | Ampicillin | PMID:12757707 | Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 2 | ||
|
M-NMn-VP64 Resource Report Resource Website 1+ mentions |
RRID:Addgene_48676 | Cas9-VP64, nuclease-null | N. meningitidis | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | nuclease-null | 2026-08-15 01:15:52 | 5 | |
|
pcDNA3.1-HA-14-3-3 ϵ Resource Report Resource Website 1+ mentions |
RRID:Addgene_48797 | YWHAE 14-3-3 ϵ | Homo sapiens | Ampicillin | PMID:12757707 | Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:54 | 2 | ||
|
M-NMcas Resource Report Resource Website 1+ mentions |
RRID:Addgene_48670 | Cas9 | N. meningitidis | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 hygro; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:52 | 2 | ||
|
M-SPn-VP64 Resource Report Resource Website 1+ mentions |
RRID:Addgene_48674 | Cas9-VP64, nuclease-null | S. pyogenes | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | nuclease-null | 2026-08-15 01:15:53 | 6 | |
|
CBIG-RORb Resource Report Resource Website 1+ mentions |
RRID:Addgene_48709 | RORb | Mus musculus | Ampicillin | Please note that Addgene's sequencing results identified a few differences in the vector backbone when compared to the full plasmid sequence from the depositing laboratory. According to the depositor, these differences are not a concern for the function of the plasmid. | Vector Backbone:CBIG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 1 | ||
|
M-ST1cas Resource Report Resource Website 1+ mentions |
RRID:Addgene_48669 | Cas9 | S. thermophilus #1 | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:52 | 7 | ||
|
pGGA004 Resource Report Resource Website |
RRID:Addgene_48815 | 35S promoter | Synthetic | Ampicillin | PMID:24376629 | This plasmid is designed for Golden Gate cloning using the BsaI enzyme. Plasmid Features (listed as bp in full plasmid sequence): BsaI site #1 = 2241-2251bp 35S promoter = 2252-3115bp BsaI site #2 = 3116-3126bp | Backbone Size:2686; Vector Backbone:pUC19; Vector Types:Golden Gate compatible cloning vector; Bacterial Resistance:Ampicillin | internal BsaI recognition site removed by substitution | 2026-08-15 01:15:53 | 0 |
|
pGGA003 Resource Report Resource Website |
RRID:Addgene_48814 | WUS promoter | Arabidopsis thaliana | Ampicillin | PMID:24376629 | This plasmid is designed for Golden Gate cloning using the BsaI enzyme. Plasmid Features (listed as bp in full plasmid sequence): BsaI site #1 = 2241-2251bp WUS promoter = 2252-6681bp BsaI site #2 = 6682-6692bp | Backbone Size:2686; Vector Backbone:pUC19; Vector Types:Golden Gate compatible cloning vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:54 | 0 | |
|
pGGA002 Resource Report Resource Website |
RRID:Addgene_48813 | AP3 promoter | Arabidopsis thaliana | Ampicillin | PMID:24376629 | This plasmid is designed for Golden Gate cloning using the BsaI enzyme. Plasmid Features (listed as bp in full plasmid sequence): BsaI site #1 = 2241-2251bp AP3 promoter = 2252-3526bp BsaI site #2 = 3527-3537bp | Backbone Size:2686; Vector Backbone:pUC19; Vector Types:Golden Gate compatible cloning vector; Bacterial Resistance:Ampicillin | internal BsaI recognition site removed by substitution | 2026-08-15 01:15:53 | 0 |
|
pcDNA3.1-nAChr-Alpha6 Resource Report Resource Website |
RRID:Addgene_48812 | nAChr-alpha6 | Mus musculus | Ampicillin | PMID:17932221 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 Zeo; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 0 | ||
|
pCDNA3.1-nAChr-beta3 Resource Report Resource Website |
RRID:Addgene_48811 | nAChr Beta 3 subunit, isoform 1 | Mus musculus | Ampicillin | PMID:17932221 | *Compared to the NCBI Genbank Entrez entry for nAChr-beta3, this plasmid has a K107R amino acid residue substitution. See accession ID: AAL75573.1|AF467896_1 for the correct reference sequence. | Backbone Marker:Life Technologies; Backbone Size:5597; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | * | 2026-08-15 01:15:54 | 0 |
|
8xLexA-binding elements/pMD20 Resource Report Resource Website 1+ mentions |
RRID:Addgene_48807 | 8xLexA-binding elements | Synthetic | Ampicillin | PMID:22043306 | Backbone Marker:Takara Bio; Backbone Size:2736; Vector Backbone:pMD20; Vector Types:; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 2 | ||
|
pRK5 HA-GST-Presc-mAkt1 (S473T) Resource Report Resource Website |
RRID:Addgene_48806 | Akt1 | Mus musculus | Ampicillin | PMID:23888043 | Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | S473T | 2026-08-15 01:15:54 | 0 | |
|
pRK5 HA-GST-Presc-mAkt1 (wt) Resource Report Resource Website 1+ mentions |
RRID:Addgene_48805 | Akt1 | Mus musculus | Ampicillin | PMID:23888043 | Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
