Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: FLAG-mVenusC-14-HP1b Chromo W42A
Vector Backbone Description: Backbone Size:4014; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28935858
Proper citation: RRID:Addgene_191399 Copy
Species: Mus musculus
Genetic Insert: FLAG-mVenusC-14-HP1b Chromo
Vector Backbone Description: Backbone Size:4014; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28935858
Proper citation: RRID:Addgene_191398 Copy
Species: Mus musculus
Genetic Insert: Yap1
Vector Backbone Description: Vector Backbone:pLKO-Tet-On; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34990589
Proper citation: RRID:Addgene_193670 Copy
Species: Mus musculus
Genetic Insert: Yap1
Vector Backbone Description: Vector Backbone:pLKO-Tet-On; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34990589
Proper citation: RRID:Addgene_193669 Copy
Species: Mus musculus
Genetic Insert: Anti-Hec1 light chain (Hec1-ms_IgG_LC)
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34970967
Proper citation: RRID:Addgene_193619 Copy
Species: Mus musculus
Genetic Insert: Bid-GFP
Vector Backbone Description: Vector Backbone:pcDNA 3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_191938 Copy
Species: Mus musculus
Genetic Insert: HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36378644
Comments: Predicted peptide sequences for 1D3 Heavy Chain:
MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK*
Proper citation: RRID:Addgene_170670 Copy
Species: Mus musculus
Genetic Insert: LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36378644
Comments: Predicted peptide sequences for 1D3 Light Chain:
MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*
Proper citation: RRID:Addgene_170669 Copy
Species: Mus musculus
Genetic Insert: Sox2-17-t2a-Klf4-e2a-cMyc
Vector Backbone Description: Backbone Size:6247; Vector Backbone:pHAGE2; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38141611
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.09.23.509242v1 for BioRxiv preprint
Proper citation: RRID:Addgene_193349 Copy
Species: Mus musculus
Genetic Insert: Tesmin
Vector Backbone Description: Backbone Marker:Masahito Ikawa; Backbone Size:7623; Vector Backbone:pCAG-Tesmin-TurboID-3xFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36564444
Proper citation: RRID:Addgene_186817 Copy
Species: Mus musculus
Genetic Insert: Tesmin
Vector Backbone Description: Backbone Marker:Masahito Ikawa; Backbone Size:5961; Vector Backbone:pCAG-MCS-BioID2-3xFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36564444
Proper citation: RRID:Addgene_186815 Copy
Species: Mus musculus
Genetic Insert: Kif 3C
Vector Backbone Description: Vector Backbone:pBeta Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36200888
Comments: pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination.
Proper citation: RRID:Addgene_193934 Copy
Species: Mus musculus
Genetic Insert: Kif 3B
Vector Backbone Description: Vector Backbone:pBeta Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36200888
Comments: pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination.
Proper citation: RRID:Addgene_193930 Copy
Species: Mus musculus
Genetic Insert: Kif 3C
Vector Backbone Description: Vector Backbone:pBeta Actin-HALO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36200888
Comments: pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination.
Proper citation: RRID:Addgene_193938 Copy
Species: Mus musculus
Genetic Insert: gRNA and smFP HA donor
Vector Backbone Description: Vector Backbone:pOC5; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35851300
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.01.02.474730v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_183441 Copy
Species: Mus musculus
Genetic Insert: gRNA and 3xGFP donor
Vector Backbone Description: Vector Backbone:pORANGE; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35851300
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.01.02.474730v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_183444 Copy
Species: Mus musculus
Genetic Insert: Stat5b
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pAD/CMV/V5-DEST; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27131881
Proper citation: RRID:Addgene_83257 Copy
Species: Mus musculus
Genetic Insert: Cacng2
Vector Backbone Description: Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35486148
Comments: Read the preprint on bioRxiv: https://www.biorxiv.org/content/10.1101/2021.04.23.441091v3.
Proper citation: RRID:Addgene_172444 Copy
Species: Mus musculus
Genetic Insert: sgRNA directing Cas9n to the proximity of Slc1a3 STOP codon
Vector Backbone Description: Vector Backbone:pX335; Vector Types:Mammalian Expression, Mouse Targeting, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33686166
Proper citation: RRID:Addgene_129410 Copy
Species: Mus musculus
Genetic Insert: Slc1a3-2A-CreERT2 Targeting Vector
Vector Backbone Description: Vector Backbone:pBlueScript; Vector Types:Mammalian Expression, Mouse Targeting, Cre/Lox; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33686166
Proper citation: RRID:Addgene_129409 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
