Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:mus musculus (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

12,959 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
FLAG-mVenusC-14-HP1b Chromo W42A
 
Resource Report
Resource Website 		RRID:Addgene_191399 FLAG-mVenusC-14-HP1b Chromo W42A Mus musculus Kanamycin PMID:28935858 Backbone Size:4014; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin W42A 2026-08-15 01:24:35 0
FLAG-mVenusC-14-HP1b Chromo
 
Resource Report
Resource Website 		RRID:Addgene_191398 FLAG-mVenusC-14-HP1b Chromo Mus musculus Kanamycin PMID:28935858 Backbone Size:4014; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:24:35 0
pLKO-Tet-On shYap1-4
 
Resource Report
Resource Website 		RRID:Addgene_193670 Yap1 Mus musculus Ampicillin PMID:34990589 Vector Backbone:pLKO-Tet-On; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:24:36 0
pLKO-Tet-On shYap1-1
 
Resource Report
Resource Website 		RRID:Addgene_193669 Yap1 Mus musculus Ampicillin PMID:34990589 Vector Backbone:pLKO-Tet-On; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:24:36 0
pDL002_Hec1-ms_IgG_LC
 
Resource Report
Resource Website 		RRID:Addgene_193619 Anti-Hec1 light chain (Hec1-ms_IgG_LC) Mus musculus Kanamycin PMID:34970967 Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:24:37 0
pcDNA3.1-Bid-GFP
 
Resource Report
Resource Website 		RRID:Addgene_191938 Bid-GFP Mus musculus Ampicillin Vector Backbone:pcDNA 3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:37 0
1D3 HC
 
Resource Report
Resource Website 		RRID:Addgene_170670 HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody Mus musculus Ampicillin PMID:36378644 Predicted peptide sequences for 1D3 Heavy Chain: MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK* Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:36 0
1D3 LC
 
Resource Report
Resource Website 		RRID:Addgene_170669 LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody Mus musculus Ampicillin PMID:36378644 Predicted peptide sequences for 1D3 Light Chain: MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:36 0
pHAGE2-TetOminiCMV-Sox2-17-t2a-Klf4-e2a-Myc
 
Resource Report
Resource Website 		RRID:Addgene_193349 Sox2-17-t2a-Klf4-e2a-cMyc Mus musculus Ampicillin PMID:38141611 Please visit https://www.biorxiv.org/content/10.1101/2022.09.23.509242v1 for BioRxiv preprint Backbone Size:6247; Vector Backbone:pHAGE2; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin Sox2-17 is engineered highly cooperative chimeric transcription factor, where the following elements of Sox2 were swapped with Sox17: 43-47, 61, 65-86 and CTD 2026-08-15 01:24:39 0
pClgn-Tesmin-TurboID-3xFLAG
 
Resource Report
Resource Website 		RRID:Addgene_186817 Tesmin Mus musculus Ampicillin PMID:36564444 Backbone Marker:Masahito Ikawa; Backbone Size:7623; Vector Backbone:pCAG-Tesmin-TurboID-3xFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:39 0
pCAG-Tesmin-BioID2-3xFLAG
 
Resource Report
Resource Website 		RRID:Addgene_186815 Tesmin Mus musculus Ampicillin PMID:36564444 Backbone Marker:Masahito Ikawa; Backbone Size:5961; Vector Backbone:pCAG-MCS-BioID2-3xFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:39 0
pBa.Halo-KIF3C tail 411-796
 
Resource Report
Resource Website 		RRID:Addgene_193934 Kif 3C Mus musculus Ampicillin PMID:36200888 pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination. Vector Backbone:pBeta Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:38 0
pBa.GFP-KIF3B CC 391-592
 
Resource Report
Resource Website 		RRID:Addgene_193930 Kif 3B Mus musculus Ampicillin PMID:36200888 pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination. Vector Backbone:pBeta Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:38 0
pBa.Halo-KIF3C DD 616-796
 
Resource Report
Resource Website 		RRID:Addgene_193938 Kif 3C Mus musculus Ampicillin PMID:36200888 pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination. Vector Backbone:pBeta Actin-HALO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:24:38 0
pOC5 smFP-HA-Cacna1e KI
 
Resource Report
Resource Website 		RRID:Addgene_183441 gRNA and smFP HA donor Mus musculus Ampicillin PMID:35851300 Please visit https://www.biorxiv.org/content/10.1101/2022.01.02.474730v1 for bioRxiv preprint. Vector Backbone:pOC5; Vector Types:CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:22:51 0
pORANGE Tubb3-3xGFP KI
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_183444 gRNA and 3xGFP donor Mus musculus Ampicillin PMID:35851300 Please visit https://www.biorxiv.org/content/10.1101/2022.01.02.474730v1 for bioRxiv preprint. Vector Backbone:pORANGE; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:22:51 1
pAD-CMV-STAT5B-CMV-GFP
 
Resource Report
Resource Website 		RRID:Addgene_83257 Stat5b Mus musculus Ampicillin PMID:27131881 Backbone Marker:Invitrogen; Vector Backbone:pAD/CMV/V5-DEST; Vector Types:Adenoviral; Bacterial Resistance:Ampicillin 2026-08-15 01:22:51 0
Stargazin-dCherry-FRB
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_172444 Cacng2 Mus musculus Kanamycin PMID:35486148 Read the preprint on bioRxiv: https://www.biorxiv.org/content/10.1101/2021.04.23.441091v3. Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:22:52 1
px335 Slc1a3 nickase 1
 
Resource Report
Resource Website 		RRID:Addgene_129410 sgRNA directing Cas9n to the proximity of Slc1a3 STOP codon Mus musculus Ampicillin PMID:33686166 Vector Backbone:pX335; Vector Types:Mammalian Expression, Mouse Targeting, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:22:52 0
Slc1a3-CreERT2 Targeting Vector
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_129409 Slc1a3-2A-CreERT2 Targeting Vector Mus musculus Ampicillin PMID:33686166 Vector Backbone:pBlueScript; Vector Types:Mammalian Expression, Mouse Targeting, Cre/Lox; Bacterial Resistance:Ampicillin 2026-08-15 01:22:52 1

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch