Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Genetic Insert: sgRNA M5
Vector Backbone Description: Vector Backbone:pT2K-CAGGS-IRES-CFP; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29880921
Proper citation: RRID:Addgene_114728 Copy
Genetic Insert: stuffer (infusion)
Vector Backbone Description: Vector Backbone:pT2K-CAGGS-T2TP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29880921
Proper citation: RRID:Addgene_114727 Copy
Genetic Insert: LacZ
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4895; Vector Backbone:pGL3; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32427827
Proper citation: RRID:Addgene_114670 Copy
Species: Mus musculus
Genetic Insert: Otopetrin 1
Vector Backbone Description: Backbone Size:3019; Vector Backbone:pGEMHE; Vector Types:For generating the mRNA, which can highly express in Xenopus laevis oocytes; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29371428
Proper citation: RRID:Addgene_114674 Copy
Species: Mus musculus
Genetic Insert: Otopetrin 2
Vector Backbone Description: Backbone Size:5429; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29371428
Proper citation: RRID:Addgene_114678 Copy
Species: Mus musculus
Genetic Insert: Otopetrin 1
Vector Backbone Description: Backbone Size:5429; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29371428
Comments: Note: mOtop1 contains G396A which is a known mutation/SNP
Proper citation: RRID:Addgene_114677 Copy
Species: Mus musculus
Genetic Insert: Otopetrin 2
Vector Backbone Description: Backbone Size:3019; Vector Backbone:pGEMHE; Vector Types:For generating the mRNA, which can highly express in Xenopus laevis oocytes; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29371428
Proper citation: RRID:Addgene_114675 Copy
Genetic Insert: LGN sgRNA
Vector Backbone Description: Vector Backbone:pX330_Addgene#42230; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29848445
Proper citation: RRID:Addgene_114715 Copy
Species: Mus musculus
Genetic Insert: Otopetrin 3
Vector Backbone Description: Backbone Size:5429; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29371428
Proper citation: RRID:Addgene_114679 Copy
Genetic Insert: NuMA
Vector Backbone Description: Vector Backbone:pMK247_addgene#105926; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29848445
Comments: Please note that some discrepancies were found between Addgene's quality control result and the depositor's full plasmid sequence. The depositor noted that these discrepancies do NOT affect plasmid function.
Proper citation: RRID:Addgene_114717 Copy
Genetic Insert: NuMA(1-1700)-RFP-Nano
Vector Backbone Description: Vector Backbone:pMK247_addgene#105926; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29848445
Comments: Please note that some discrepancies were found between Addgene's quality control result and the depositor's full plasmid sequence. The depositor noted that these discrepancies do NOT affect plasmid function.
Proper citation: RRID:Addgene_114700 Copy
Genetic Insert: NuMA(1-505)-RFP-Nano
Vector Backbone Description: Vector Backbone:pMK247_addgene#105926; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29848445
Proper citation: RRID:Addgene_114704 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: ATG9
Vector Backbone Description: Backbone Size:4297; Vector Backbone:pRS406; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27050455
Proper citation: RRID:Addgene_114669 Copy
Genetic Insert: NuMA(1-705)4A-RFP-Nano
Vector Backbone Description: Vector Backbone:pMK247_addgene#105926; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29848445
Proper citation: RRID:Addgene_114702 Copy
Genetic Insert: NuMA(1-213)-RFP-Nano
Vector Backbone Description: Vector Backbone:pMK247_addgene#105926; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29848445
Proper citation: RRID:Addgene_114706 Copy
Species: Homo sapiens
Genetic Insert: UbcH5b
Vector Backbone Description: Backbone Marker:see PMID 1852137; Backbone Size:5000; Vector Backbone:pGEX-KG; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_11477 Copy
Species: Arabidopsis thaliana
Genetic Insert: AT3G25560
Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29320478
Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: GVNFEVVALIGIKSSLTDPHGVLMNWDDTAVDPCSWNMITCSDGFVIRLEAPSQNLSGTLSSSIGNLTNLQTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLSYNNLSGPVPRSLAKTFNVMGNSQICPTGTEKDCNGTQPKPMSITLNSSQNKSSDGGTK
Proper citation: RRID:Addgene_114773 Copy
Species: Arabidopsis thaliana
Genetic Insert: AT2G13790
Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29320478
Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: GNAEGDALTQLKNSLSSGDPANNVLQSWDATLVTPCTWFHVTCNPENKVTRVDLGNAKLSGKLVPELGQLLNLQYLELYSNNITGEIPEELGDLVELVSLDLYANSISGPIPSSLGKLGKLRFLRLNNNSLSGEIPMTLTSVQLQVLDISNNRLSGDIPVNGSFSLFTPISFANNSLTDLPEPPPTSTSPTPPPPSGG
Proper citation: RRID:Addgene_114770 Copy
Species: Arabidopsis thaliana
Genetic Insert: AT4G30520
Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29320478
Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: SEPRNPEVEALISIRNNLHDPHGALNNWDEFSVDPCSWAMITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNLSGPVPKFPARTFNVAGNPLICRSNPPEICSGSINASPLSVSLSSSSGRR
Proper citation: RRID:Addgene_114774 Copy
Species: Arabidopsis thaliana
Genetic Insert: AT5G45780
Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29320478
Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: SPKGVNYEVAALMSVKNKMKDEKEVLSGWDINSVDPCTWNMVGCSSEGFVVSLEMASKGLSGILSTSIGELTHLHTLLLQNNQLTGPIPSELGQLSELETLDLSGNRFSGEIPASLGFLTHLNYLRLSRNLLSGQVPHLVAGLSGLSFLDLSFNNLSGPTPNISAKDYRIVGNAFLCGPASQELCSDATPVRNATGLSEKDNS
Proper citation: RRID:Addgene_114778 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
