Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117901 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSHHHHHH
Proper citation: RRID:Addgene_117900 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117899 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH
Proper citation: RRID:Addgene_117898 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117997 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117999 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-mCitrine
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Comments: mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function.
Proper citation: RRID:Addgene_117989 Copy
Species: Arabidopsis thaliana
Genetic Insert: Csy4
Vector Backbone Description: Vector Backbone:pTKan-GW-R1R2; Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28094975
Proper citation: RRID:Addgene_110145 Copy
Species: Arabidopsis thaliana
Genetic Insert: Csy4
Vector Backbone Description: Vector Backbone:pTKan-GW-R1R2; Vector Types:Bacterial Expression, Plant Expression, binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28094975
Proper citation: RRID:Addgene_110143 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase 4 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 4 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127522 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase 2 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 2 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127521 Copy
Species: Arabidopsis thaliana
Genetic Insert: CaMV 35S reverse complement promoter sequence flanked by attB/attP Integrase 2, 4 and 5 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The CaMV 35S promoter in a reverse complement sequence orientation came from iGEM registry (BBa_K1547006 ) and the attB/P integrases 2, 4 and 5 attatchment sites flanking this sequence came from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014). This cassete was previously synthesized in pBluescript II SK(-) and after cloned using HindIII and BamHI replacing the forward CaMV 35S promoter sequence from a 35S-GFP plasmid construction of Chiu, W. et al. Curr. Biol. 6, 325-330 (1996).
Proper citation: RRID:Addgene_127520 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase 7 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 7 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127524 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase Bxb1 attachment sites.
Vector Backbone Description: Vector Backbone:pBluescript SK(-); Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase Bxb1 attachment sites sequences from Bonnet, J. et al. Science 340, 599-603 (2013) (Genbank KC529327.1); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127528 Copy
Species: Arabidopsis thaliana
Genetic Insert: U6-26p::sgRNA scaffold
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:3017; Vector Backbone:pGEM T-easy; Vector Types:Plant Expression, CRISPR, Synthetic Biology, Subcloning; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34541122
Comments: The new version of pFH6 (pFH6_new) provides > 10 times higher mutation efficiencies than the original version. In combination with pUB-Cas9, homozygous knockout plants can be created in Arabidopsis in the T2 generation at efficiencies of 50-100%.
For cloning procedure, please use the attached protocol which is derived from Hahn et al., 2017 ( http://www.bio-protocol.org/e2384 ).
Proper citation: RRID:Addgene_105866 Copy
Species: Arabidopsis thaliana
Genetic Insert: GAI-tagBFP-Sp dCas9-ABI
Vector Backbone Description: Backbone Marker:System Biosciences; Vector Backbone:PB; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27776111
Proper citation: RRID:Addgene_106895 Copy
Species: Arabidopsis thaliana
Genetic Insert: CIBN-MP; CRY2 PHRolig-VHH(GFP)
Vector Backbone Description: Vector Backbone:pHW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30759894
Proper citation: RRID:Addgene_126026 Copy
Species: Arabidopsis thaliana
Genetic Insert: CIBN-MP; CRY2 PHR-VHH(GFP)
Vector Backbone Description: Vector Backbone:pHW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30759894
Proper citation: RRID:Addgene_126024 Copy
Species: Arabidopsis thaliana
Genetic Insert: ARF17
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:3000; Vector Backbone:pBluescript II SK+; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15829600
Comments: The genomic sequence of ARF17 (At1g77850), including 1.9 and 1.7 kb of putative 5' and 3' regulatory sequences, respectively, was cloned as an 6.6-kb EcoRI-SpeI fragment into pBluescript II SK+ (Stratagene, La Jolla, CA) from the BAC F28K19. See "sequence" for full insert sequence.
Proper citation: RRID:Addgene_12068 Copy
Species: Arabidopsis thaliana
Genetic Insert: CUC1 mutant
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGreenII0129; Vector Types:plant transformation via Agrobacterium; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15202996
Comments: See "sequence" for full insert sequence. See article for cloning details.
Proper citation: RRID:Addgene_12067 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
