Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
ERrefGFP1_pCDNA3 Resource Report Resource Website |
RRID:Addgene_48635 | ERrefGFP1 | Jellyfish | Ampicillin | PMID:23589496 | Backbone Size:5393; Vector Backbone:pCDNA3 derivative; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | C147S,C204Q | 2026-08-15 01:15:52 | 0 | |
|
ERroGFP_iE_C204Q_pCDNA3 Resource Report Resource Website |
RRID:Addgene_48629 | ERroGFP | jellyfish | Ampicillin | PMID:23589496 | Backbone Size:5370; Vector Backbone:pcDNA3 derivative; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | insertion E147B, C204Q | 2026-08-15 01:15:52 | 0 | |
|
pPB-CAG-3xFLAG-empty-pgk-hph Resource Report Resource Website 1+ mentions |
RRID:Addgene_48754 | Ampicillin | PMID:23582324 | Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing. | Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:54 | 3 | |||
|
pPB-CAG-empty-pgk-hph Resource Report Resource Website 1+ mentions |
RRID:Addgene_48753 | Ampicillin | PMID:23582324 | Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing. | Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 4 | |||
|
pPy-CAG-GFP-IRES-Pac Resource Report Resource Website 1+ mentions |
RRID:Addgene_48759 | EGFP | Synthetic | Ampicillin | PMID:23582324 | Backbone Size:6600; Vector Backbone:Bluescript; Vector Types:Mammalian Expression, pPy; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 1 | ||
|
pPB-CAG-Tfe3::ERT2-pgk-hph Resource Report Resource Website |
RRID:Addgene_48756 | Tfe3::ERT2 | Mus musculus | Ampicillin | PMID:23582324 | Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 0 | ||
|
pCMV10-Flag-Fbxl3 Resource Report Resource Website |
RRID:Addgene_48751 | Fbxl3 | Mus musculus | Ampicillin | PMID:17462724 | Backbone Marker:Sigma; Backbone Size:6299; Vector Backbone:p3xFLAG-CMV-10; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:54 | 0 | ||
|
pGL3 Resource Report Resource Website 10+ mentions |
RRID:Addgene_48743 | truncated mPer2 promoter/enhancer region (-1128 to +1060) | Mus musculus | Ampicillin | PMID:15699353 | Minor sequencing discrepancies may exist between the mPer2 promoter reference sequence and Addgene's sequencing results, but do not affect the function of the plasmid. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-Basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin | truncated promoter region (see pGL6) | 2026-08-15 01:15:53 | 17 |
|
pGL2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_48742 | truncated mPer2 promoter/enhancer region (-1128 to +386) | Mus musculus | Ampicillin | PMID:15699353 | Minor sequencing discrepancies may exist between the mPer2 promoter reference sequence and Addgene's sequencing results, but do not affect the function of the plasmid. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-Basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin | truncated promoter region (see pGL6) | 2026-08-15 01:15:53 | 1 |
|
pGL3 basic Mut E2 Resource Report Resource Website |
RRID:Addgene_48748 | mPer2 promoter/enhancer region containing mutated E-box2 (-112 to +98) | Mus musculus | Ampicillin | PMID:15699353 | Minor sequencing discrepancies may exist between the mPer2 promoter reference sequence and Addgene's sequencing results, but do not affect the function of the plasmid. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-Basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin | Mutated E-box2 sequence from CACGTT to GCTAGT | 2026-08-15 01:15:54 | 0 |
|
pGL5 Resource Report Resource Website |
RRID:Addgene_48745 | truncated mPer2 promoter/enhancer region (-1128 to +2064) | Mus musculus | Ampicillin | PMID:15699353 | Minor sequencing discrepancies may exist between the mPer2 promoter reference sequence and Addgene's sequencing results, but do not affect the function of the plasmid. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-Basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin | truncated promoter region (see pGL6) | 2026-08-15 01:15:54 | 0 |
|
pET-UNC60B Resource Report Resource Website |
RRID:Addgene_48740 | C. elegans UNC-60B cDNA | Caenorhabditis elegans | Ampicillin | PMID:9452511 | Please see the insert sequence provided by the depositing laboratory and Figure 1 from the associated publication (Ono S and Benian GM, JBC 1998) listed below for information on the UNC-60 isoform in this plasmid. This plasmid encodes the UNC-60B isoform as described in the publication and now referred to as UNC-60C by NCBI and Wormbase (GenBank reference sequence NP_503427.2). The original nomenclature of UNC-60A and UNC-60B was defined in the publication "Genetic organization of the unc-60 region in Caenorhabditis elegans." McKim KS, Heschl MF, Rosenbluth RE, Baillie DL. Genetics. 1988 Jan;118(1):49-59. https://www.ncbi.nlm.nih.gov/pubmed/8608931 | Backbone Marker:Novagen; Backbone Size:459; Vector Backbone:pET-3d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 0 | |
|
pTYB-pLAC-L108S/L109S/F112S Resource Report Resource Website |
RRID:Addgene_48730 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Leucine 108 and 109 to Serine; phenylalanine 112 to Serine | 2026-08-15 01:15:53 | 0 |
|
pFRT-TODestFLAGHAhFMRPiso1I304N Resource Report Resource Website 1+ mentions |
RRID:Addgene_48692 | FlagHA FMR1 Iso 1 I304N | Homo sapiens | Ampicillin | PMID:23235829 | Backbone Marker:Life Technologies, Modified by Tuschl Lab; Backbone Size:5322; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 3 | ||
|
pTYB-pLAC-I68S/I73S Resource Report Resource Website |
RRID:Addgene_48728 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Isoleucine 68 and 73 to Serine | 2026-08-15 01:15:53 | 0 |
|
pTYB1-pLAC-I73S Resource Report Resource Website |
RRID:Addgene_48722 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Isoleucine 73 to Serine | 2026-08-15 01:15:53 | 0 |
|
pUltra-Chili-Luc Resource Report Resource Website 10+ mentions |
RRID:Addgene_48688 | Ampicillin | PMID:34088832 | See Addgene plasmid #24129 for cloning details. | Backbone Marker:Malcolm Moore lab; Vector Backbone:pUltra-Chili; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 33 | |||
|
pTYB1-pLAC-V69S Resource Report Resource Website |
RRID:Addgene_48721 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Valine 69 to Serine | 2026-08-15 01:15:53 | 0 |
|
pUltra-Chili Resource Report Resource Website 10+ mentions |
RRID:Addgene_48687 | Ampicillin | See Addgene plasmid #24129 for cloning details. | Backbone Marker:Malcolm Moore lab; Backbone Size:8300; Vector Backbone:pUltra; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 19 | ||||
|
pTYB1-pLAC-N71 Resource Report Resource Website |
RRID:Addgene_48720 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: SILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Deleted first 71 amino acids of mature lacritin without signal peptide | 2026-08-15 01:15:53 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
