Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 193 showing 3841 ~ 3860 out of 33,857 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_166561

http://www.addgene.org/166561

Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 2521

Proper citation: RRID:Addgene_166561 Copy   


  • RRID:Addgene_166560

http://www.addgene.org/166560

Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 9255

Proper citation: RRID:Addgene_166560 Copy   


  • RRID:Addgene_166518

http://www.addgene.org/166518

Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 23476

Proper citation: RRID:Addgene_166518 Copy   


  • RRID:Addgene_166519

http://www.addgene.org/166519

Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 6597

Proper citation: RRID:Addgene_166519 Copy   


http://www.addgene.org/166763

Species: Synthetic
Genetic Insert: ActA tail anchor (Listeria monocytogenes)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "SGLRSRGSGLRSRAQASNSAVDARGSGLRSRAQASNSAVDARGSGLRSRAQASNSAVDAR GSGLRSRAQASNSAVDARV" amino acid targeting sequence, which we refer to as "ActA", for the mitochondrial outer membrane. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "79aa" indicates the 79 amino acid flexible linker region between Venus and the ActA targeting signal.

Proper citation: RRID:Addgene_166763 Copy   


http://www.addgene.org/166762

Species: Homo sapiens
Genetic Insert: Noxa
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker.

Proper citation: RRID:Addgene_166762 Copy   


  • RRID:Addgene_166761

    This resource has 1+ mentions.

http://www.addgene.org/166761

Species: Homo sapiens
Genetic Insert: BimEL(Mus musculus)-(Noxa BH3)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: BH3 region removed and inserted BH3 of Noxa protein. There is a K107E mutation in the Venus sequence of this plasmid. The K107E mutation is facing outwards in the B-Barrel structure of the Venus protein. Therefore, it is unlikely that this mutation would affect the chromophore within the β-barrel. We have transfected this plasmid in BMK-DKO cells and did not observe aggregation. We also used this construct and observed Forster resonance energy transfer from mCerulean3 in the context of measuring interactions with two binding partners. Thus, this mutation does not appear to affect the Venus fluorophore.

Proper citation: RRID:Addgene_166761 Copy   


http://www.addgene.org/166765

Species: Homo sapiens
Genetic Insert: MAO tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.

Proper citation: RRID:Addgene_166765 Copy   


http://www.addgene.org/166764

Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal.

Proper citation: RRID:Addgene_166764 Copy   


  • RRID:Addgene_166705

http://www.addgene.org/166705

Species: Homo sapiens
Genetic Insert: AMOT PPxY1 fused to NEDD4L WW3
Vector Backbone Description: Backbone Size:5597; Vector Backbone:pCA528; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34284061

Proper citation: RRID:Addgene_166705 Copy   


  • RRID:Addgene_166734

    This resource has 1+ mentions.

http://www.addgene.org/166734

Species: Mus musculus
Genetic Insert: BimL
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBimL" (Venus fused to the N-terminus of the BH3-only protein, BimL) in live cells. There is a 3 amino acid flexible linker between Venus and BimL proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166734 Copy   


  • RRID:Addgene_166737

    This resource has 1+ mentions.

http://www.addgene.org/166737

Species: Homo sapiens
Genetic Insert: Bik
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: Transfection of this plasmid will express "VBik" (Venus fused to the N-terminus of the BH3-only protein, Bik) in live cells. There is an 8 amino acid flexible linker between Venus and Bik proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166737 Copy   


  • RRID:Addgene_166736

    This resource has 1+ mentions.

http://www.addgene.org/166736

Species: Mus musculus
Genetic Insert: tBid
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VtBid" (Venus fused to the N-terminus of the BH3-only protein, truncated Bid (tBid)) in live cells. In cells, caspase 8 cleavage of Bid produces the p15 fragment, referred to as tBid. There is a 3 amino acid flexible linker between Venus and tBid proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166736 Copy   


  • RRID:Addgene_166735

    This resource has 1+ mentions.

http://www.addgene.org/166735

Species: Mus musculus
Genetic Insert: BimEL
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBimEL" (Venus fused to the N-terminus of the BH3-only protein, BimEL) in live cells. There is a 3 amino acid flexible linker between Venus and BimEL proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166735 Copy   


  • RRID:Addgene_166739

    This resource has 1+ mentions.

http://www.addgene.org/166739

Species: Homo sapiens
Genetic Insert: Puma
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: Transfection of this plasmid will express "VPuma" (Venus fused to the N-terminus of the BH3-only protein, Puma) in live cells. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric. In cloning, the last amino acid of Venus protein was deleted (K239S). Result is a 1 amino acid linker between Venus and Puma proteins. The encoded BBC3 isoform 4 is also known as PUMA-alpha.

Proper citation: RRID:Addgene_166739 Copy   


  • RRID:Addgene_166740

    This resource has 1+ mentions.

http://www.addgene.org/166740

Species: Homo sapiens
Genetic Insert: Bad-4E
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBad-4E" (Venus fused to the N-terminus of the BH3-only protein, Bad-4E) in live cells. There is a flexible, 7 amino acid linker between Venus and Bad-4E proteins. Full length Bad protein with BH3 region hydrophobic positions H1-H4 mutated to glutamic acid (E), refered to as "BH3-4E" mutation, BH3 mutations: Y110E, L114E, M117E, F122E. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166740 Copy   


  • RRID:Addgene_166743

    This resource has 1+ mentions.

http://www.addgene.org/166743

Species: Mus musculus
Genetic Insert: tBid-4E
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: Transfection of this plasmid will express "VtBid-4E" (Venus fused to the N-terminus of the BH3-only protein, truncated Bid (tBid)) in live cells. In cells, caspase 8 cleavage of Bid produces the p15 fragment, referred to as tBid. BH3 region has hydrophobic positions H1-H4 mutated to glutamic acid (E). BH3, Mutations: I27E, L31E, I34E, M38E. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166743 Copy   


  • RRID:Addgene_166742

    This resource has 1+ mentions.

http://www.addgene.org/166742

Species: Mus musculus
Genetic Insert: BimEL-4E
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBimEL-4E" (Venus fused to the N-terminus of the BH3-only protein, BimEL-4E) in live cells. There is a 3 amino acid flexible linker between Venus and BimEL-4E proteins. BH3 region has hydrophobic positions H1-H4 mutated to glutamic acid (E), refered to as "BH3-4E" mutation, BH3 mutations: I146E, L150E, I153E, F157E. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.

Proper citation: RRID:Addgene_166742 Copy   


  • RRID:Addgene_176897

http://www.addgene.org/176897

Species: Mus musculus
Genetic Insert: Integrin-linked kinase
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35259013
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.03.30.437490v1 for bioRxiv preprint.

Proper citation: RRID:Addgene_176897 Copy   


  • RRID:Addgene_17708

    This resource has 1+ mentions.

http://www.addgene.org/17708

Species: Homo sapiens
Genetic Insert: rent1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12228722

Proper citation: RRID:Addgene_17708 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X