Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: BRCA1
Vector Backbone Description: Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33097066
Proper citation: RRID:Addgene_119008 Copy
Species: Homo sapiens
Genetic Insert: Rad18
Vector Backbone Description: Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33097066
Proper citation: RRID:Addgene_119005 Copy
Species: Homo sapiens
Genetic Insert: Rad18
Vector Backbone Description: Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33097066
Proper citation: RRID:Addgene_119003 Copy
Species: Homo sapiens
Genetic Insert: RNF169
Vector Backbone Description: Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33097066
Proper citation: RRID:Addgene_119004 Copy
Species: Homo sapiens
Genetic Insert: iRFP682-Smad2
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:piRFP682-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29241005
Proper citation: RRID:Addgene_118943 Copy
Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182
Proper citation: RRID:Addgene_118986 Copy
Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182
Proper citation: RRID:Addgene_118985 Copy
Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182
Proper citation: RRID:Addgene_118988 Copy
Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182
Proper citation: RRID:Addgene_118987 Copy
Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182
Proper citation: RRID:Addgene_118989 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3G-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119139 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3F-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119138 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3B L1 intron-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119135 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3C-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119136 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3H Haplotype II RR175/6EE-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119142 Copy
Species: Homo sapiens
Genetic Insert: APOBEC3H Haplotype II-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582
Proper citation: RRID:Addgene_119141 Copy
Species: Homo sapiens
Genetic Insert: RICS-PX (127-255)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: NVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESS
Proper citation: RRID:Addgene_119126 Copy
Species: Homo sapiens
Genetic Insert: p47phox-PX (1-122)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRP
Proper citation: RRID:Addgene_119124 Copy
Species: Homo sapiens
Genetic Insert: SNX8-PX (70-190)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: ELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESA
Proper citation: RRID:Addgene_119089 Copy
Species: Homo sapiens
Genetic Insert: SNX17-PX (1-111)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQ
Proper citation: RRID:Addgene_119098 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
