Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Mentions:yes (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

32,424 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pCAG-mcherry-WIPI2d-cs-TEV-STREP
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_178912 WIPI2d Homo sapiens Ampicillin PMID:34505572 Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:11:19 1
pET-30a(+)-Syk-tSH2
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111269 murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:48 1
pbabe-hTERT+p53DD
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_11128 hTERT, p53 dominant negative Homo sapiens Ampicillin PMID:16267004 This plasmid was generated by cloning FLAG-hTERT cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site p53DD cDNA in which HindIII/ClaI sites were again added by PCR. Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin p53 dominant negative (aa1-14; 303-390) 2026-08-15 01:01:48 6
pSW002-Pc-E2-Crimson
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111252 E2-Crimson Synthetic Tetracycline PMID:29449848 Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline 2026-08-15 01:01:48 2
pbabe-cyclinD1+CDK4R24C
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_11129 Cyclin D1, Cyclin Dependent Kinase 4 Homo sapiens Ampicillin PMID:16267004 This plasmid was generated by cloning cyclinD1 cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site CDK4R24C cDNA in which HindIII/ClaI sites were again added by PCR. Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin CDK4 R24C 2026-08-15 01:01:48 6
HsCLYBL-FLAG
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111290 human CLYBL Homo sapiens Ampicillin PMID:29056341 Backbone Size:7500; Vector Backbone:pLys1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:48 1
PSUPER-344(hPot1)
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_11133 RNAi against human Protection of Telomeres 1 Homo sapiens Ampicillin PMID:15620654 Target sequence is: TACCT CGCAC TTCAA GCAA. Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin N/A 2026-08-15 01:01:49 1
Prp40-pET21b
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111287 PRP40 Saccharomyces cerevisiae Ampicillin PMID:24231520 Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:48 1
pbabe-c-mycT58A+HRasG12V
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_11130 c-myc, HRas Homo sapiens Ampicillin PMID:16267004 Contains mouse c-myc and human Hras. This plasmid was generated by cloning c-MycT58A cDNA with flanking BamHI-EcoRI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site H-RasG12V cDNA in which HindIII/ClaI sites were again added by PCR. Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin c-myc T58A, A156T, and G438R; and H-Ras G12V 2026-08-15 01:01:49 6
pET-30a(+)-N-SH2
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111274 murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:48 1
pET-30a(+)-Syk-tSH2-FX
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111272 murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin interdomain A (Phe 119 to His 162) substituted by a flexible 20-amino-acid linker (GGS)3GS(GGS)3 2026-08-15 01:01:48 1
pAAV-hSyn-DIO {ChETA-mRuby2}on-W3SL
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111389 ChETA-mRuby2 Synthetic Ampicillin PMID:29879392 Backbone Size:4116; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:01:49 1
pScaf
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111401 Ampicillin PMID:30984875 Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682 Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:50 1
pScaf-7560.1
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111406 pScaf-7560.1 Ampicillin PMID:30984875 Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682 Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:50 1
Kv7.1/pcDNA3.1
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111452 potassium voltage-gated channel subfamily KQT member 1 isoform 1 [Homo sapiens] Homo sapiens Ampicillin PMID:29429937 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:50 4
pVG1
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111444 CaCas9/sgScADE2/stop-codon repair Synthetic Ampicillin PMID:29695624 Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:50 1
pAAV-hSyn-DIO {mCAR}off-{GCaMP6f}on-WPRE
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111393 mCAR Mus musculus Ampicillin PMID:29879392 Backbone Size:4836; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:01:49 1
pAAV-hSyn-DIO {hCAR}off-{hM4Di-mCherry}on-W3SL
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111397 hCAR Homo sapiens Ampicillin PMID:29879392 Backbone Size:4117; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:01:49 3
pV1382
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111436 CaCas9/sgRNA-BsmBI stuffer Synthetic Ampicillin PMID:29695624 Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:50 9
pV1326
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_111435 CaCas9/sgRNA-BsmBI stuffer Synthetic Ampicillin PMID:29695624 Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:50 1

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.