Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pCAG-mcherry-WIPI2d-cs-TEV-STREP Resource Report Resource Website 1+ mentions |
RRID:Addgene_178912 | WIPI2d | Homo sapiens | Ampicillin | PMID:34505572 | Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:11:19 | 1 | ||
|
pET-30a(+)-Syk-tSH2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111269 | murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:48 | 1 | |
|
pbabe-hTERT+p53DD Resource Report Resource Website 1+ mentions |
RRID:Addgene_11128 | hTERT, p53 dominant negative | Homo sapiens | Ampicillin | PMID:16267004 | This plasmid was generated by cloning FLAG-hTERT cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site p53DD cDNA in which HindIII/ClaI sites were again added by PCR. | Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | p53 dominant negative (aa1-14; 303-390) | 2026-08-15 01:01:48 | 6 |
|
pSW002-Pc-E2-Crimson Resource Report Resource Website 1+ mentions |
RRID:Addgene_111252 | E2-Crimson | Synthetic | Tetracycline | PMID:29449848 | Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline | 2026-08-15 01:01:48 | 2 | ||
|
pbabe-cyclinD1+CDK4R24C Resource Report Resource Website 1+ mentions |
RRID:Addgene_11129 | Cyclin D1, Cyclin Dependent Kinase 4 | Homo sapiens | Ampicillin | PMID:16267004 | This plasmid was generated by cloning cyclinD1 cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site CDK4R24C cDNA in which HindIII/ClaI sites were again added by PCR. | Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | CDK4 R24C | 2026-08-15 01:01:48 | 6 |
|
HsCLYBL-FLAG Resource Report Resource Website 1+ mentions |
RRID:Addgene_111290 | human CLYBL | Homo sapiens | Ampicillin | PMID:29056341 | Backbone Size:7500; Vector Backbone:pLys1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:48 | 1 | ||
|
PSUPER-344(hPot1) Resource Report Resource Website 1+ mentions |
RRID:Addgene_11133 | RNAi against human Protection of Telomeres 1 | Homo sapiens | Ampicillin | PMID:15620654 | Target sequence is: TACCT CGCAC TTCAA GCAA. | Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin | N/A | 2026-08-15 01:01:49 | 1 |
|
Prp40-pET21b Resource Report Resource Website 1+ mentions |
RRID:Addgene_111287 | PRP40 | Saccharomyces cerevisiae | Ampicillin | PMID:24231520 | Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:48 | 1 | ||
|
pbabe-c-mycT58A+HRasG12V Resource Report Resource Website 1+ mentions |
RRID:Addgene_11130 | c-myc, HRas | Homo sapiens | Ampicillin | PMID:16267004 | Contains mouse c-myc and human Hras. This plasmid was generated by cloning c-MycT58A cDNA with flanking BamHI-EcoRI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site H-RasG12V cDNA in which HindIII/ClaI sites were again added by PCR. | Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | c-myc T58A, A156T, and G438R; and H-Ras G12V | 2026-08-15 01:01:49 | 6 |
|
pET-30a(+)-N-SH2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111274 | murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:48 | 1 | |
|
pET-30a(+)-Syk-tSH2-FX Resource Report Resource Website 1+ mentions |
RRID:Addgene_111272 | murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | interdomain A (Phe 119 to His 162) substituted by a flexible 20-amino-acid linker (GGS)3GS(GGS)3 | 2026-08-15 01:01:48 | 1 |
|
pAAV-hSyn-DIO {ChETA-mRuby2}on-W3SL Resource Report Resource Website 1+ mentions |
RRID:Addgene_111389 | ChETA-mRuby2 | Synthetic | Ampicillin | PMID:29879392 | Backbone Size:4116; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:49 | 1 | ||
|
pScaf Resource Report Resource Website 1+ mentions |
RRID:Addgene_111401 | Ampicillin | PMID:30984875 | Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682 | Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:50 | 1 | |||
|
pScaf-7560.1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111406 | pScaf-7560.1 | Ampicillin | PMID:30984875 | Preprint available at https://www.biorxiv.org/content/early/2018/04/27/309682 | Backbone Size:3154; Vector Backbone:pScaf; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:50 | 1 | ||
|
Kv7.1/pcDNA3.1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111452 | potassium voltage-gated channel subfamily KQT member 1 isoform 1 [Homo sapiens] | Homo sapiens | Ampicillin | PMID:29429937 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:50 | 4 | ||
|
pVG1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111444 | CaCas9/sgScADE2/stop-codon repair | Synthetic | Ampicillin | PMID:29695624 | Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:50 | 1 | ||
|
pAAV-hSyn-DIO {mCAR}off-{GCaMP6f}on-WPRE Resource Report Resource Website 1+ mentions |
RRID:Addgene_111393 | mCAR | Mus musculus | Ampicillin | PMID:29879392 | Backbone Size:4836; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:49 | 1 | ||
|
pAAV-hSyn-DIO {hCAR}off-{hM4Di-mCherry}on-W3SL Resource Report Resource Website 1+ mentions |
RRID:Addgene_111397 | hCAR | Homo sapiens | Ampicillin | PMID:29879392 | Backbone Size:4117; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:49 | 3 | ||
|
pV1382 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111436 | CaCas9/sgRNA-BsmBI stuffer | Synthetic | Ampicillin | PMID:29695624 | Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:50 | 9 | ||
|
pV1326 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111435 | CaCas9/sgRNA-BsmBI stuffer | Synthetic | Ampicillin | PMID:29695624 | Backbone Marker:RS Sikorski; Vector Backbone:pRS416; Vector Types:Yeast Expression, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:50 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
