Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: L. mobilis
Genetic Insert: L. mobilis type I-E cse2
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178748 Copy
Species: A. chroococcum
Genetic Insert: A. chroococcum type I-E #3 cse2
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178742 Copy
Species: A. chroococcum
Genetic Insert: A. chroococcum type I-E #3 cas7
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178745 Copy
Species: A. chroococcum
Genetic Insert: A. chroococcum type I-E #3 cas5
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178743 Copy
Species: Marinomonas sp.
Genetic Insert: Marinomonas sp. type I-E cas5
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178761 Copy
Species: A. chroococcum
Genetic Insert: A. chroococcum type I-E #2 cas6
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178738 Copy
Species: A. chroococcum
Genetic Insert: A. chroococcum type I-E #2 cas7
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178739 Copy
Species: A. chroococcum
Genetic Insert: A. chroococcum type I-E #2 cse2
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35216669
Comments: If used in a publication, please acknowledge that the plasmid pEcCas5 was generated by U.S. Department of Energy Joint Genome Institute, a DOE Office of Science User Facility. The associated work was supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.
Proper citation: RRID:Addgene_178736 Copy
Species: Synthetic
Genetic Insert: EF1a-NlaCas7c-bGH PolyA
Vector Backbone Description: Backbone Marker:Lucigen; Backbone Size:1993; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35051351
Proper citation: RRID:Addgene_178879 Copy
Species: Synthetic
Genetic Insert: mScarlet counter-selection cassette
Vector Backbone Description: Backbone Size:4943; Vector Backbone:BASIC_SEVA_25a.10; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36381610
Comments: Cloning method: BASIC DNA assembly . Please visit https://www.biorxiv.org/content/10.1101/2022.01.06.446575v2 for bioRxiv preprint.
Proper citation: RRID:Addgene_178918 Copy
Species: Homo sapiens
Genetic Insert: potassium voltage-gated channel subfamily KQT member 5 isoform 1 [Homo sapiens]
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29429937
Proper citation: RRID:Addgene_111267 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111269 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: CWC25
Vector Backbone Description: Vector Backbone:pET28B; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111340 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: CWC25
Vector Backbone Description: Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111341 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: PRP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5370; Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111348 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SPP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111349 Copy
Species: Homo sapiens
Genetic Insert: human CLYBL ( aa23-340) codon optimized for bacterial expression
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pET30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29056341
Proper citation: RRID:Addgene_111288 Copy
Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG
Proper citation: RRID:Addgene_111274 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111272 Copy
Species: Homo sapiens
Genetic Insert: hH1-ARRET
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pENTR/D-hH1; Vector Types:Gateway Entry Cloning; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_111382 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
