Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: SARS-CoV-2
Genetic Insert: Nucleocapsid
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.09.10.459410v2 for bioRxiv preprint.
Proper citation: RRID:Addgene_170467 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 secretable trimeric Spike
Vector Backbone Description: Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36619904
Comments: The SARS-CoV-2 secretable trimeric Spike insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]).
This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 secretable trimeric Spike protein. This protein can be recovered from the cell culture medium by His-tag purification.
Please note that this plasmid is intended to be used as a DNA template of the spike gene but not as a construct for protein production. The protein produced using this plasmid is not antigenically functional.
Proper citation: RRID:Addgene_161794 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF10
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)GYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
Proper citation: RRID:Addgene_162819 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF7b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)IELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA - UniProtKB - P0DTD8 (NS7B_SARS2)
Proper citation: RRID:Addgene_162818 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_M
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)ADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ - UniProtKB - P0DTC5 (VME1_SARS2)
Proper citation: RRID:Addgene_162815 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF9c/14
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)LQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD
Proper citation: RRID:Addgene_162820 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF3b(CoV1h)
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: SARS1-CoV homolog ORF3b with premature stop codon as described in Konno et. al., 2020 (doi:10.1016/j.celrep.2020.108185) - Protein sequence: (TAG)PTIFFAGILIVTTIVYLTIV
Proper citation: RRID:Addgene_162822 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1844-1945)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167263 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1619-1945)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167262 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1-111)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167257 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1050-1216)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167259 Copy
Species: SARS-CoV-2
Genetic Insert: nsp10
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp10_SARS2:MVC019-B04:C245486
Proper citation: RRID:Addgene_167851 Copy
Species: SARS-CoV-2
Genetic Insert: nsp16
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2:MVC019-B03:C245485
Proper citation: RRID:Addgene_167850 Copy
Species: SARS-CoV-2
Genetic Insert: nsp10, nsp16
Vector Backbone Description: Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2-nsp10_SARS-MVC019-A11:C245481
Proper citation: RRID:Addgene_167848 Copy
Species: SARS-CoV-2
Genetic Insert: nsp10
Vector Backbone Description: Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp10_SARS2:MVC019-A04:C245474
Proper citation: RRID:Addgene_167847 Copy
Species: SARS-CoV-2
Genetic Insert: nsp16
Vector Backbone Description: Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33423577
Comments: SGC clone sample ID: nsp16_SARS2:MVC019-A03:C245473
Proper citation: RRID:Addgene_167846 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Tim Whitehead (Addgene #168778); Vector Backbone:pJS697; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34416153
Proper citation: RRID:Addgene_168777 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Tim Whitehead (Addgene #168778); Vector Backbone:pJS697; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34416153
Proper citation: RRID:Addgene_168776 Copy
Species: SARS-CoV-2
Genetic Insert: nsp12-3xFlag/nsp7-His6-nsp8
Vector Backbone Description: Vector Backbone:pBIG2abc (biGBac); Vector Types:Insect Expression; Bacterial Resistance:Chloramphenicol and Ampicillin
Defining Citation: PMID:34198323
Comments: Baculovirus generation using Tn7 transposition (Bac-to-Bac).
Proper citation: RRID:Addgene_169183 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Nsp3 Mac1
Vector Backbone Description: Backbone Size:5358; Vector Backbone:pET22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33853786
Proper citation: RRID:Addgene_169210 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
