Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pHAGE N-mNeonGreen (from SARS-CoV-2) IRES puro Resource Report Resource Website |
RRID:Addgene_170467 | Nucleocapsid | SARS-CoV-2 | Ampicillin | Please visit https://www.biorxiv.org/content/10.1101/2021.09.10.459410v2 for bioRxiv preprint. | Vector Backbone:pHAGE; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:10:08 | 0 | ||
|
pSBbi-RP-CoV2/stSpike-puro Resource Report Resource Website |
RRID:Addgene_161794 | SARS-CoV-2 secretable trimeric Spike | SARS-CoV-2 | Ampicillin | PMID:36619904 | The SARS-CoV-2 secretable trimeric Spike insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]). This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 secretable trimeric Spike protein. This protein can be recovered from the cell culture medium by His-tag purification. Please note that this plasmid is intended to be used as a DNA template of the spike gene but not as a construct for protein production. The protein produced using this plasmid is not antigenically functional. | Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:57 | 0 | |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF10 Resource Report Resource Website |
RRID:Addgene_162819 | Ub-(N-TAG)CoV2_ORF10 | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)GYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF10(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF7b Resource Report Resource Website |
RRID:Addgene_162818 | Ub-(N-TAG)CoV2_ORF7b | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)IELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA - UniProtKB - P0DTD8 (NS7B_SARS2) | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF7b(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_M Resource Report Resource Website |
RRID:Addgene_162815 | Ub-(N-TAG)CoV2_M | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)ADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ - UniProtKB - P0DTC5 (VME1_SARS2) | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_M(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF9c/14 Resource Report Resource Website |
RRID:Addgene_162820 | Ub-(N-TAG)CoV2_ORF9c/14 | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)LQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF9c/14(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b(CoV1h) Resource Report Resource Website |
RRID:Addgene_162822 | Ub-(N-TAG)CoV2_ORF3b(CoV1h) | SARS-CoV-2 | Ampicillin | PMID:33175524 | SARS1-CoV homolog ORF3b with premature stop codon as described in Konno et. al., 2020 (doi:10.1016/j.celrep.2020.108185) - Protein sequence: (TAG)PTIFFAGILIVTTIVYLTIV | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF3b(CoV1h)(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pMCSG53_Nsp3_Y_3 Resource Report Resource Website |
RRID:Addgene_167263 | Nsp3 (residues 1844-1945) | SARS-CoV-2 | Ampicillin | Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | none | 2026-08-15 01:09:42 | 0 | ||
|
pMCSG53_Nsp3_Y_2 Resource Report Resource Website |
RRID:Addgene_167262 | Nsp3 (residues 1619-1945) | SARS-CoV-2 | Ampicillin | Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | none | 2026-08-15 01:09:42 | 0 | ||
|
pMCSG53_Nsp3_Ubl1 Resource Report Resource Website |
RRID:Addgene_167257 | Nsp3 (residues 1-111) | SARS-CoV-2 | Ampicillin | Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | none | 2026-08-15 01:09:42 | 0 | ||
|
pMCSG53_Nsp3_NAB_1 Resource Report Resource Website |
RRID:Addgene_167259 | Nsp3 (residues 1050-1216) | SARS-CoV-2 | Ampicillin | Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | none | 2026-08-15 01:09:42 | 0 | ||
|
pET28-MHL: nsp10_SARS-CoV-2 Resource Report Resource Website |
RRID:Addgene_167851 | nsp10 | SARS-CoV-2 | Kanamycin | PMID:33423577 | SGC clone sample ID: nsp10_SARS2:MVC019-B04:C245486 | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:47 | 0 | |
|
pET28-MHL: nsp16_SARS-CoV-2 Resource Report Resource Website |
RRID:Addgene_167850 | nsp16 | SARS-CoV-2 | Kanamycin | PMID:33423577 | SGC clone sample ID: nsp16_SARS2:MVC019-B03:C245485 | Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:47 | 0 | |
|
p28BIOHTEV-LIC: nsp16_SARS-CoV-2|nsp10_SARS-CoV-2 Resource Report Resource Website |
RRID:Addgene_167848 | nsp10, nsp16 | SARS-CoV-2 | Kanamycin | PMID:33423577 | SGC clone sample ID: nsp16_SARS2-nsp10_SARS-MVC019-A11:C245481 | Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:47 | 0 | |
|
p28BIOHTEV-LIC: nsp10_SARS-CoV-2 Resource Report Resource Website |
RRID:Addgene_167847 | nsp10 | SARS-CoV-2 | Kanamycin | PMID:33423577 | SGC clone sample ID: nsp10_SARS2:MVC019-A04:C245474 | Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:47 | 0 | |
|
p28BIOHTEV-LIC: nsp16_SARS-CoV-2 Resource Report Resource Website |
RRID:Addgene_167846 | nsp16 | SARS-CoV-2 | Kanamycin | PMID:33423577 | SGC clone sample ID: nsp16_SARS2:MVC019-A03:C245473 | Backbone Marker:SGC Toronto; Vector Backbone:p28BIOHTEV-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:47 | 0 | |
|
SARS-CoV-2 Spike (S) Receptor Binding Domain (RBD) library 2 Resource Report Resource Website |
RRID:Addgene_168777 | SARS-CoV-2 RBD | SARS-CoV-2 | Kanamycin | PMID:34416153 | Backbone Marker:Tim Whitehead (Addgene #168778); Vector Backbone:pJS697; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:56 | 0 | ||
|
SARS-CoV-2 Spike (S) Receptor Binding Domain (RBD) library 1 Resource Report Resource Website |
RRID:Addgene_168776 | SARS-CoV-2 RBD | SARS-CoV-2 | Kanamycin | PMID:34416153 | Backbone Marker:Tim Whitehead (Addgene #168778); Vector Backbone:pJS697; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:55 | 0 | ||
|
pBIG2abc_nsp12-3xFlag/nsp7-His6-nsp8 (SARS-CoV-2) Resource Report Resource Website |
RRID:Addgene_169183 | nsp12-3xFlag/nsp7-His6-nsp8 | SARS-CoV-2 | Chloramphenicol and Ampicillin | PMID:34198323 | Baculovirus generation using Tn7 transposition (Bac-to-Bac). | Vector Backbone:pBIG2abc (biGBac); Vector Types:Insect Expression; Bacterial Resistance:Chloramphenicol and Ampicillin | Codon optimised for insect cells (Spodoptera frugiperda) | 2026-08-15 01:09:57 | 0 |
|
Nsp3 Mac1 - P43 (Oxford) Resource Report Resource Website |
RRID:Addgene_169210 | SARS-CoV-2 Nsp3 Mac1 | SARS-CoV-2 | Ampicillin | PMID:33853786 | Backbone Size:5358; Vector Backbone:pET22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:09:57 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
