Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: PRORP1
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Comments: The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”
Proper citation: RRID:Addgene_67869 Copy
Species: Arabidopsis thaliana
Genetic Insert: PIAL2
Vector Backbone Description: Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25415977
Proper citation: RRID:Addgene_67909 Copy
Species: Arabidopsis thaliana
Genetic Insert: Cold temperature germinating 10 (CTG10)
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29632208
Proper citation: RRID:Addgene_67911 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Proper citation: RRID:Addgene_67870 Copy
Species: Arabidopsis thaliana
Genetic Insert: Promoter_AtU6-26 + sgRNA_BolC.GA4a-2
Vector Backbone Description: Vector Backbone:pICH47761 (AddGene #48003); Vector Types:Plant Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26616834
Comments: Target sequence: GTTGAGAGGGGAGCCGGTGA
Proper citation: RRID:Addgene_68256 Copy
Species: Arabidopsis thaliana
Genetic Insert: Promoter: U6-26 (Arabidopsis thaliana)
Vector Backbone Description: Vector Backbone:pAGM9121; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:26616834
Proper citation: RRID:Addgene_68261 Copy
Species: Arabidopsis thaliana
Genetic Insert: At2S3 promoter
Vector Backbone Description: Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23669743
Comments: insert can be released with BsaI
Proper citation: RRID:Addgene_68162 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtUbq10 promoter
Vector Backbone Description: Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23669743
Comments: insert can be released with BsaI
Proper citation: RRID:Addgene_68174 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtHsp70B promoter
Vector Backbone Description: Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23669743
Comments: insert can be released with BsaI
Proper citation: RRID:Addgene_68172 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtHsp18.2 promoter
Vector Backbone Description: Backbone Marker:self-made; derived from pGEMT-Easy manufactured by Promega; Vector Backbone:pUPD; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23669743
Comments: insert can be released with BsaI
Proper citation: RRID:Addgene_68171 Copy
Species: Arabidopsis thaliana
Genetic Insert: OPTX promoter with cGMPRE
Vector Backbone Description: Backbone Marker:Calderon-Villalobos et al 2006 Plant Physiol 141:3-14 (GenBank: AY968054.1); Backbone Size:7272; Vector Backbone:pLUC Trap3 (GW); Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24206622
Proper citation: RRID:Addgene_68503 Copy
Species: Arabidopsis thaliana
Genetic Insert: OPTX promoter with GARE
Vector Backbone Description: Backbone Marker:Calderon-Villalobos et al 2006 Plant Physiol 141:3-14 (GenBank: AY968054.1); Backbone Size:7272; Vector Backbone:pLUC Trap3 (GW); Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24206622
Comments: linker sequence between inserted GARE is 5' gagagcc 3'
Proper citation: RRID:Addgene_68542 Copy
Species: Arabidopsis thaliana
Genetic Insert: LexABD-CRY2
Vector Backbone Description: Backbone Marker:custom ; Vector Backbone:pDBTrp; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25350266
Proper citation: RRID:Addgene_78210 Copy
Species: Arabidopsis thaliana
Genetic Insert: PAL2
Vector Backbone Description: Backbone Size:2999; Vector Backbone:pSTV28; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:21722749
Comments: *Note: Addgene's quality control sequencing finds an E50A amino acid residue substitution in the A. thaliana PAL2 gene insert. The depositing laboratory does not believe this residue change will affect protein function. This plasmid accurately reflects the construct as it was used in the associated publication.
Proper citation: RRID:Addgene_78286 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase 4 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 4 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127522 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase 2 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 2 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127521 Copy
Species: Arabidopsis thaliana
Genetic Insert: CaMV 35S reverse complement promoter sequence flanked by attB/attP Integrase 2, 4 and 5 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The CaMV 35S promoter in a reverse complement sequence orientation came from iGEM registry (BBa_K1547006 ) and the attB/P integrases 2, 4 and 5 attatchment sites flanking this sequence came from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014). This cassete was previously synthesized in pBluescript II SK(-) and after cloned using HindIII and BamHI replacing the forward CaMV 35S promoter sequence from a 35S-GFP plasmid construction of Chiu, W. et al. Curr. Biol. 6, 325-330 (1996).
Proper citation: RRID:Addgene_127520 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase 7 attachment sites.
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase 7 attachment sites sequences from Yang, L. et al. Nat. Methods 11, 1261-1266 (2014); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127524 Copy
Species: Arabidopsis thaliana
Genetic Insert: EGFP reverse complement coding sequence flanked by attB/attP Integrase Bxb1 attachment sites.
Vector Backbone Description: Vector Backbone:pBluescript SK(-); Vector Types:Plant Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32444777
Comments: The whole insert (promoter, CDS and terminator) was synthesized and cloned into backbone plasmid. The CaMV 35S promoter sequence is derived from iGEM registry (BBa_K1547006); the EGFP coding sequence from Chiu, W. et al. Curr. Biol. 6, 325-330 (1996); the attB/P integrase Bxb1 attachment sites sequences from Bonnet, J. et al. Science 340, 599-603 (2013) (Genbank KC529327.1); and the NOS terminator sequence from pBI426 plasmid of Datla, R.S., et al. Gene 101, 239-246 (1991).
Proper citation: RRID:Addgene_127528 Copy
Species: Arabidopsis thaliana
Genetic Insert: OsTIR
Vector Backbone Description: Vector Backbone:pBSK; Vector Types:Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34106828
Proper citation: RRID:Addgene_127910 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
