Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
Proper citation: RRID:Addgene_104215 Copy
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI
Proper citation: RRID:Addgene_104214 Copy
Genetic Insert: mito-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024
Proper citation: RRID:Addgene_104309 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRD
Proper citation: RRID:Addgene_104274 Copy
Species: Homo sapiens
Genetic Insert: BHMT
Vector Backbone Description: Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18059170
Comments: GFP is from Aequorea victoria
Proper citation: RRID:Addgene_104442 Copy
Species: Arabidopsis thaliana
Genetic Insert: sgRNA-transRNA transcription by U6 promoter
Vector Backbone Description: Backbone Marker:Lampropoulos et al., 2013; Vector Backbone:pE000; Vector Types:Bacterial Expression, Plant Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30083222
Proper citation: RRID:Addgene_104441 Copy
Genetic Insert: enhanced green fluorescent protein
Vector Backbone Description: Backbone Marker:The piggyBac vector backbone was a gift from George Church, Addgene plasmid #63800; Vector Backbone:PiggyBac; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30900179
Proper citation: RRID:Addgene_104454 Copy
Species: Homo sapiens
Genetic Insert: vesicle-associated membrane protein-associated protein B
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24105263
Proper citation: RRID:Addgene_104450 Copy
Species: Synthetic
Genetic Insert: 12xMS2V6
Vector Backbone Description: Backbone Marker:Genescript; Vector Backbone:pUC57; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29131164
Comments: Plasmid synthesized by Genescript with insert cloned in inverted direction
Proper citation: RRID:Addgene_104390 Copy
Species: Synthetic
Genetic Insert: 24xMS2V6
Vector Backbone Description: Backbone Marker:Genescript; Vector Backbone:pUC57; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29131164
Comments: Insert generated by duplication of 12xMBSV6 as a BamHI/BglII fragment inserted at the BglII site
Proper citation: RRID:Addgene_104391 Copy
Species: E. coli
Genetic Insert: rpoA-rpoB-rpoC-6xHis and rpoZ
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25665556
Comments: Plasmid pVS10 encodes the E. coli rpoA-rpoB-rpoC [His6] and
rpoZ ORFs under control of T7 promoter.
Proper citation: RRID:Addgene_104398 Copy
Species: Homo sapiens
Genetic Insert: gamma-tubulin 1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29050966
Proper citation: RRID:Addgene_104433 Copy
Species: Synthetic
Genetic Insert: 24xMS2V6
Vector Backbone Description: Vector Backbone:pUC; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29131164
Comments: Insert cloned from pET259 as BamHI SalI in Addgene plasmid #45162, replacing previous MS2 variant
Proper citation: RRID:Addgene_104393 Copy
Species: Rattus norvegicus
Genetic Insert: jGCaMP7b
Vector Backbone Description: Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31209382
Comments: Please visit https://www.biorxiv.org/content/10.1101/434589v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_104484 Copy
Species: Rattus norvegicus
Genetic Insert: jGCaMP7f
Vector Backbone Description: Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31209382
Comments: Please visit https://www.biorxiv.org/content/10.1101/434589v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_104483 Copy
Species: Homo sapiens
Genetic Insert: LSD1
Vector Backbone Description: Backbone Marker:Keith Joung (Addgene plasmid # 47754); Backbone Size:9075; Vector Backbone:pMLM3705; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Comments: Backbone modification: added Hygromycin resistance cassette (PGK promoter and Hygromycin resistance gene from Addgene Plasmid 41721 (MSCVhygro- F-G9a), SV40 early polyadenylation signal from the pCDNA3.1 backbone of Addgene Plasmid 13820 (HDAC1 Flag). LSD1A isoform B catalytic domain (a.a. 171-852) was from LSD1 cDNA clone IRATp970A0364D (Source Bioscience). The P405H change in this cDNA clone was reverted to the consensus during Gibson assembly.
Proper citation: RRID:Addgene_104406 Copy
Species: Homo sapiens
Genetic Insert: CD9
Vector Backbone Description: Backbone Marker:Thermo Fisher; Backbone Size:9351; Vector Backbone:pLenti6.3/TO/V5-DEST; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29221804
Comments: Plasmid is used and named CD9-GFP in publication even though it contains mEmerald. Described in the methods of Boker et al 2018 (https://www.ncbi.nlm.nih.gov/pubmed/29221804). Please see publication for more information.
Also see the following article for additional information on using this plasmid: Schiller et al., 2018 https://www.sciencedirect.com/science/article/pii/S2329050118300378
Proper citation: RRID:Addgene_104402 Copy
Species: E. coli
Genetic Insert: rpoA, B, C, and Z
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET; Vector Types:Bacterial Expression, E. coli expression vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25665556
Comments: pIA900 (rpoA, B, C, and Z) encodes a C-terminally His-tagged β′ which can be removed using TEV protease. Linker with TEV-His10 cloned between NheI and StuI sites of pIA787; NheI site is gone
Proper citation: RRID:Addgene_104401 Copy
Species: Homo sapiens
Genetic Insert: SLC30A10
Vector Backbone Description: Backbone Size:4700; Vector Backbone:pEGFP-N3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28883040
Proper citation: RRID:Addgene_104381 Copy
Vector Backbone Description: Backbone Marker:Zhang Lab; Vector Backbone:lentiguide puro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29224777
Comments: Follow Zhang Lab protocol for lentiguide-puro cloning
Proper citation: RRID:Addgene_104375 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
