Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 225 showing 4481 ~ 4500 out of 12,972 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_193669

http://www.addgene.org/193669

Species: Mus musculus
Genetic Insert: Yap1
Vector Backbone Description: Vector Backbone:pLKO-Tet-On; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34990589

Proper citation: RRID:Addgene_193669 Copy   


http://www.addgene.org/193619

Species: Mus musculus
Genetic Insert: Anti-Hec1 light chain (Hec1-ms_IgG_LC)
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34970967

Proper citation: RRID:Addgene_193619 Copy   


  • RRID:Addgene_170670

http://www.addgene.org/170670

Species: Mus musculus
Genetic Insert: HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36378644
Comments: Predicted peptide sequences for 1D3 Heavy Chain: MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK*

Proper citation: RRID:Addgene_170670 Copy   


  • RRID:Addgene_170669

http://www.addgene.org/170669

Species: Mus musculus
Genetic Insert: LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36378644
Comments: Predicted peptide sequences for 1D3 Light Chain: MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*

Proper citation: RRID:Addgene_170669 Copy   


http://www.addgene.org/193349

Species: Mus musculus
Genetic Insert: Sox2-17-t2a-Klf4-e2a-cMyc
Vector Backbone Description: Backbone Size:6247; Vector Backbone:pHAGE2; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38141611
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.09.23.509242v1 for BioRxiv preprint

Proper citation: RRID:Addgene_193349 Copy   


http://www.addgene.org/186817

Species: Mus musculus
Genetic Insert: Tesmin
Vector Backbone Description: Backbone Marker:Masahito Ikawa; Backbone Size:7623; Vector Backbone:pCAG-Tesmin-TurboID-3xFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36564444

Proper citation: RRID:Addgene_186817 Copy   


http://www.addgene.org/186815

Species: Mus musculus
Genetic Insert: Tesmin
Vector Backbone Description: Backbone Marker:Masahito Ikawa; Backbone Size:5961; Vector Backbone:pCAG-MCS-BioID2-3xFLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36564444

Proper citation: RRID:Addgene_186815 Copy   


http://www.addgene.org/193934

Species: Mus musculus
Genetic Insert: Kif 3C
Vector Backbone Description: Vector Backbone:pBeta Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36200888
Comments: pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_193934 Copy   


http://www.addgene.org/193930

Species: Mus musculus
Genetic Insert: Kif 3B
Vector Backbone Description: Vector Backbone:pBeta Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36200888
Comments: pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_193930 Copy   


http://www.addgene.org/193938

Species: Mus musculus
Genetic Insert: Kif 3C
Vector Backbone Description: Vector Backbone:pBeta Actin-HALO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36200888
Comments: pBa vector is susceptible to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_193938 Copy   


http://www.addgene.org/224573

Species: Mus musculus
Genetic Insert: sh RNAi Diacylglycerol kinase alfa mouse
Vector Backbone Description: Backbone Marker:Oligoengine; Backbone Size:3176; Vector Backbone:pSUPER; Vector Types:RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28163304

Proper citation: RRID:Addgene_224573 Copy   


http://www.addgene.org/224576

Species: Mus musculus
Genetic Insert: sh RNAi Diacylglycerol kinase alfa mouse
Vector Backbone Description: Backbone Marker:Oligoengine; Backbone Size:8371; Vector Backbone:pSUPER Retro GFP; Vector Types:Retroviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28163304

Proper citation: RRID:Addgene_224576 Copy   


  • RRID:Addgene_224408

http://www.addgene.org/224408

Species: Mus musculus
Genetic Insert: Kif 13a
Vector Backbone Description: Vector Backbone:pBeta-Actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38598291
Comments: pBa vector is susceptable to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_224408 Copy   


  • RRID:Addgene_224409

http://www.addgene.org/224409

Species: Mus musculus
Genetic Insert: KIF 13a S1371A
Vector Backbone Description: Vector Backbone:pBeta-Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38598291
Comments: pBa vector is susceptable to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_224409 Copy   


  • RRID:Addgene_224410

http://www.addgene.org/224410

Species: Mus musculus
Genetic Insert: KIF 13a WLDLE
Vector Backbone Description: Vector Backbone:pBeta-Actin-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38598291
Comments: pBa vector is susceptable to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_224410 Copy   


http://www.addgene.org/224415

Species: Mus musculus
Genetic Insert: Pex3
Vector Backbone Description: Vector Backbone:pBeta-Actin-tdTM-FKBP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38598291
Comments: pBa vector is susceptable to recombination and should not be grown in fast growing bacteria or cloned using recombination.

Proper citation: RRID:Addgene_224415 Copy   


  • RRID:Addgene_205636

http://www.addgene.org/205636

Species: Mus musculus
Genetic Insert: reRNA-mmSCN9A
Vector Backbone Description: Vector Backbone:pKM-U6-reRNA-acceptor-2xBbsI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39313558

Proper citation: RRID:Addgene_205636 Copy   


  • RRID:Addgene_225830

http://www.addgene.org/225830

Species: Mus musculus
Genetic Insert: Mouse anti-CGG IgK chain, Streptag-II-tagged
Vector Backbone Description: Vector Backbone:pIgK; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36646114

Proper citation: RRID:Addgene_225830 Copy   


http://www.addgene.org/225399

Species: Mus musculus
Genetic Insert: Anti-SLC13A5/NaCT (Homo sapiens) recombinant (Mouse) monoclonal antibody.
Vector Backbone Description: Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2a; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37758930
Comments: RRID: AB_3112118. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology. Research Institute.

Proper citation: RRID:Addgene_225399 Copy   


http://www.addgene.org/225410

Species: Mus musculus
Genetic Insert: Anti-Ankyrin-B (Homo sapiens) recombinant (Mouse) monoclonal antibody.
Vector Backbone Description: Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2b; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37758930
Comments: RRID: AB_3112071 . Isotype: IgG2b. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology. Research Institute.

Proper citation: RRID:Addgene_225410 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X