Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: mCherry
Vector Backbone Description: Vector Backbone:pSC101; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156371 Copy
Species: Synthetic
Genetic Insert: mMaroon1
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156388 Copy
Species: Synthetic
Genetic Insert: E2-Crimson
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156387 Copy
Species: Synthetic
Genetic Insert: mCarmine
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156384 Copy
Species: Synthetic
Genetic Insert: Katushka-9-5
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156383 Copy
Species: Synthetic
Genetic Insert: MiCy
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156386 Copy
Species: Synthetic
Genetic Insert: mScarlet-I
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156381 Copy
Species: Synthetic
Genetic Insert: Nsp10
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAVx
Proper citation: RRID:Addgene_156479 Copy
Species: Synthetic
Genetic Insert: Nsp7
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQx
Proper citation: RRID:Addgene_156476 Copy
Species: Synthetic
Genetic Insert: Nsp9
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQx
Proper citation: RRID:Addgene_156478 Copy
Species: Synthetic
Genetic Insert: Nsp8
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQx
Proper citation: RRID:Addgene_156477 Copy
Species: Synthetic
Genetic Insert: Nsp3c_SUD-C
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: MDSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLR
Proper citation: RRID:Addgene_156471 Copy
Species: Synthetic
Genetic Insert: Nsp3e_NAB
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETx
Proper citation: RRID:Addgene_156473 Copy
Species: Synthetic
Genetic Insert: Nsp15
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLx
Proper citation: RRID:Addgene_156481 Copy
Species: Synthetic
Genetic Insert: Flag-8His
Vector Backbone Description: Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33313418
Proper citation: RRID:Addgene_157677 Copy
Species: Synthetic
Genetic Insert: 12x601_30bp linker
Vector Backbone Description: Vector Backbone:pWM; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31543265
Comments: occasional plasmid instability in dam-/dcm- strains
High copy plasmid (pUC-based, but medium yield)
Proper citation: RRID:Addgene_157789 Copy
Species: Synthetic
Genetic Insert: 12x601_25bp linker
Vector Backbone Description: Vector Backbone:pWM; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31543265
Comments: occasional plasmid instability in dam-/dcm- strains
High copy plasmid (pUC-based, but medium yield)
Proper citation: RRID:Addgene_157788 Copy
Species: Synthetic
Genetic Insert: pMD2.G(spei/spei)&12x601_tetO
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pCR™BluntII-TOPO®; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:31543265
Comments: High copy plasmid (pUC-based, but medium yield)
Proper citation: RRID:Addgene_157785 Copy
Species: Synthetic
Genetic Insert: 12x601_20bp linker
Vector Backbone Description: Vector Backbone:pWM; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31543265
Comments: occasional plasmid instability in dam-/dcm- strains
High copy plasmid (pUC-based, but medium yield)
Proper citation: RRID:Addgene_157787 Copy
Species: Synthetic
Genetic Insert: 12x601_45bp linker
Vector Backbone Description: Vector Backbone:pWM; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31543265
Comments: occasional plasmid instability in dam-/dcm- strains
High copy plasmid (pUC-based, but medium yield)
Proper citation: RRID:Addgene_157791 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.