Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 222584
Proper citation: RRID:Addgene_166551 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 5859
Proper citation: RRID:Addgene_166557 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 10056
Proper citation: RRID:Addgene_166556 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 51592
Proper citation: RRID:Addgene_166550 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32817337
Comments: Genbank acc. no of scFv: MT074308. Target NCBI gene ID: 51520. The antigen-containing plasmid can be found under Addgene catalog ID: 153052 (https://www.addgene.org/153052/)
Proper citation: RRID:Addgene_166542 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32817337
Comments: Genbank acc. no of scFv: MT074309. Target NCBI gene ID: 4141. The antigen-containing plasmid can be found under Addgene catalog ID: 153053 (https://www.addgene.org/153053/)
Proper citation: RRID:Addgene_166541 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 55023
Proper citation: RRID:Addgene_166547 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 54209
Proper citation: RRID:Addgene_166545 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT8; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 3576
Proper citation: RRID:Addgene_166544 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 212
Proper citation: RRID:Addgene_166549 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 2521
Proper citation: RRID:Addgene_166561 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 9255
Proper citation: RRID:Addgene_166560 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 23476
Proper citation: RRID:Addgene_166518 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 6597
Proper citation: RRID:Addgene_166519 Copy
Species: Homo sapiens
Genetic Insert: GGamma5-GFP2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32367019
Comments: These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community.
Proper citation: RRID:Addgene_166777 Copy
Species: Homo sapiens
Genetic Insert: GGamma10-GFP2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32367019
Comments: These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community.
Proper citation: RRID:Addgene_166779 Copy
Species: Homo sapiens
Genetic Insert: Noxa
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker.
Proper citation: RRID:Addgene_166762 Copy
Species: Homo sapiens
Genetic Insert: BimEL(Mus musculus)-(Noxa BH3)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: BH3 region removed and inserted BH3 of Noxa protein. There is a K107E mutation in the Venus sequence of this plasmid. The K107E mutation is facing outwards in the B-Barrel structure of the Venus protein. Therefore, it is unlikely that this mutation would affect the chromophore within the β-barrel. We have transfected this plasmid in BMK-DKO cells and did not observe aggregation. We also used this construct and observed Forster resonance energy transfer from mCerulean3 in the context of measuring interactions with two binding partners. Thus, this mutation does not appear to affect the Venus fluorophore.
Proper citation: RRID:Addgene_166761 Copy
Species: Homo sapiens
Genetic Insert: MAO tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.
Proper citation: RRID:Addgene_166765 Copy
Species: Homo sapiens
Genetic Insert: Angiomotin p130 L129A P130A
Vector Backbone Description: Backbone Size:5446; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166711 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
