Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
T-FAM83BA-6 Resource Report Resource Website |
RRID:Addgene_166551 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 222584 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
Z-QARS-1 Resource Report Resource Website |
RRID:Addgene_166557 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 5859 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
Z-FARSB-5 Resource Report Resource Website |
RRID:Addgene_166556 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 10056 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
T-TRIM33-4 Resource Report Resource Website |
RRID:Addgene_166550 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 51592 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
O-LARS-15 Resource Report Resource Website |
RRID:Addgene_166542 | single chain-Fv, scFv | Homo sapiens | Kanamycin | PMID:32817337 | Genbank acc. no of scFv: MT074308. Target NCBI gene ID: 51520. The antigen-containing plasmid can be found under Addgene catalog ID: 153052 (https://www.addgene.org/153052/) | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | |
|
O-MARS-11 Resource Report Resource Website |
RRID:Addgene_166541 | single chain-Fv, scFv | Homo sapiens | Kanamycin | PMID:32817337 | Genbank acc. no of scFv: MT074309. Target NCBI gene ID: 4141. The antigen-containing plasmid can be found under Addgene catalog ID: 153053 (https://www.addgene.org/153053/) | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | |
|
Q-PHIPA-23 Resource Report Resource Website |
RRID:Addgene_166547 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 55023 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
O-TREM2-2 Resource Report Resource Website |
RRID:Addgene_166545 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 54209 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
O-IL8-15 Resource Report Resource Website |
RRID:Addgene_166544 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 3576 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT8; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
Q-ALAS2A-11 Resource Report Resource Website |
RRID:Addgene_166549 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 212 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
Z-FUS-5 Resource Report Resource Website |
RRID:Addgene_166561 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 2521 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
Z-AIMP1-1 Resource Report Resource Website |
RRID:Addgene_166560 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 9255 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
G-BRD4-4 Resource Report Resource Website |
RRID:Addgene_166518 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 23476 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
G-SMARCA4-2 Resource Report Resource Website |
RRID:Addgene_166519 | single chain-Fv, scFv | Homo sapiens | Kanamycin | Target NCBI gene ID: 6597 | Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:36 | 0 | ||
|
pcDNA3.1-GGamma5-GFP2 Resource Report Resource Website |
RRID:Addgene_166777 | GGamma5-GFP2 | Homo sapiens | Ampicillin | PMID:32367019 | These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community. | Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Contains an N-terminal GFP2 and GSAG linker | 2026-08-15 01:09:38 | 0 |
|
pcDNA3.1-GGamma10-GFP2 Resource Report Resource Website |
RRID:Addgene_166779 | GGamma10-GFP2 | Homo sapiens | Ampicillin | PMID:32367019 | These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community. | Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Contains an N-terminal GFP2 and GSAG linker | 2026-08-15 01:09:38 | 0 |
|
Venus-30aa-Noxa-pEGFP-C1 Resource Report Resource Website |
RRID:Addgene_166762 | Noxa | Homo sapiens | Kanamycin | Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker. | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:38 | 0 | ||
|
Venus-BimEL(Noxa)-pEGFP-C1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_166761 | BimEL(Mus musculus)-(Noxa BH3) | Homo sapiens | Kanamycin | PMID:35442739 | BH3 region removed and inserted BH3 of Noxa protein. There is a K107E mutation in the Venus sequence of this plasmid. The K107E mutation is facing outwards in the B-Barrel structure of the Venus protein. Therefore, it is unlikely that this mutation would affect the chromophore within the β-barrel. We have transfected this plasmid in BMK-DKO cells and did not observe aggregation. We also used this construct and observed Forster resonance energy transfer from mCerulean3 in the context of measuring interactions with two binding partners. Thus, this mutation does not appear to affect the Venus fluorophore. | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | BH3 region removed and inserted BH3 of human Noxa protein | 2026-08-15 01:09:38 | 1 |
|
Venus-7aa-MAO-pEGFP-C3 Resource Report Resource Website |
RRID:Addgene_166765 | MAO tail anchor | Homo sapiens | Kanamycin | "WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria. | Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:38 | 0 | ||
|
pcDNA3HA-AMOT p130∆PPxY1 Resource Report Resource Website |
RRID:Addgene_166711 | Angiomotin p130 L129A P130A | Homo sapiens | Ampicillin | PMID:34284061 | Backbone Size:5446; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | changed leucine 129 to alanine, proline 130 to alanine | 2026-08-15 01:09:37 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
