Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Other
Genetic Insert: TurboID (BirA mutant)
Vector Backbone Description: Vector Backbone:pRS415; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107167 Copy
Species: Other
Genetic Insert: ITGA6-promoter
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pGL3-Basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28604746
Proper citation: RRID:Addgene_107141 Copy
Species: Other
Genetic Insert: colEwt2/Imwt2
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEwt2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKGSNKTNIQKGKAPFARKKDQVGGRERFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imwt2: MELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107127 Copy
Species: Other
Genetic Insert: miniTurbo (BirA mutant)
Vector Backbone Description: Vector Backbone:pET21a; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107178 Copy
Species: Other
Genetic Insert: TurboID (BirA mutant)
Vector Backbone Description: Vector Backbone:pET21a; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107177 Copy
Species: Other
Genetic Insert: miniTurbo (BirA mutant)
Vector Backbone Description: Vector Backbone:pLX304; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107176 Copy
Species: Other
Genetic Insert: SpCas9
Vector Backbone Description: Backbone Marker:Richard Sherwood Lab; Backbone Size:6982; Vector Backbone:sgBbsI (p2Tol-U6-2xBbsI-sgRNA-HygR); Vector Types:Mammalian Expression, Bacterial Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30405244
Proper citation: RRID:Addgene_107190 Copy
Species: Other
Genetic Insert: hSyn-mCherry-P2A-Cre-WPRE
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29335603
Proper citation: RRID:Addgene_107312 Copy
Species: Other
Genetic Insert: CAG-LSL-dCas9-10xGCN4-P2A-scFv-P65-HSF1-T2A-EGFP-WPRE-PolyA
Vector Backbone Description: Vector Backbone:PB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin and Kanamycin
Defining Citation: PMID:29335603
Proper citation: RRID:Addgene_107307 Copy
Species: Other
Genetic Insert: A3A-Cas9-UDG-T2A-AP lyase
Vector Backbone Description: Vector Backbone:pHUE411; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32601432
Proper citation: RRID:Addgene_167361 Copy
Species: Other
Genetic Insert: LoxP-mKate-LoxP-EGFP
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34807503
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.02.16.431359v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_167940 Copy
Species: Other
Genetic Insert: AsCas12f1
Vector Backbone Description: Vector Backbone:p15a; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34475565
Proper citation: RRID:Addgene_171609 Copy
Species: Other
Genetic Insert: Bxb1 integrase
Vector Backbone Description: Vector Backbone:Custom; Vector Types:Mammalian Expression, Lentiviral, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34270613
Proper citation: RRID:Addgene_171588 Copy
Species: Other
Genetic Insert: AsCas12f1 and sgRNA_v1
Vector Backbone Description: Vector Backbone:ColE1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34475565
Proper citation: RRID:Addgene_171614 Copy
Species: Other
Genetic Insert: NLS-AsCas12f1-NLS
Vector Backbone Description: Vector Backbone:ColE1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34475565
Proper citation: RRID:Addgene_171613 Copy
Species: Other
Genetic Insert: AsCas12f1_sgRNA_1
Vector Backbone Description: Vector Backbone:ColE1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34475565
Proper citation: RRID:Addgene_171611 Copy
Species: Other
Genetic Insert: sgRNA scaffold-nSaCas9-NLS
Vector Backbone Description: Vector Backbone:pCMV; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33972728
Proper citation: RRID:Addgene_171695 Copy
Species: Other
Genetic Insert: MBP-mCherry-8xHis-SacB(-)
Vector Backbone Description: Backbone Marker:Center for Eukaryotic Structural Genomics (CESG); Vector Backbone:pVP65K; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34749604
Comments: Korean patent: Auto-induction Plasmid, 10-2286426.
For more information, please see Chae YK (2021) FASEB J, https://doi.org/10.1096/fasebj.2021.35.S1.01779
Proper citation: RRID:Addgene_171646 Copy
Species: Other
Genetic Insert: EGFP
Vector Backbone Description: Vector Backbone:Custom; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34270613
Proper citation: RRID:Addgene_171599 Copy
Species: Other
Genetic Insert: mCherry
Vector Backbone Description: Vector Backbone:Custom; Vector Types:Mammalian Expression, Synthetic Biology, Promoterless Bxb1 DNA recombination; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34270613
Proper citation: RRID:Addgene_171598 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
