Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 245 showing 4881 ~ 4900 out of 177,820 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_48680

    This resource has 1+ mentions.

http://www.addgene.org/48680

Species: Mus musculus
Genetic Insert: Nanog
Vector Backbone Description: Vector Backbone:pCR2.1TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23992847

Proper citation: RRID:Addgene_48680 Copy   


  • RRID:Addgene_48683

http://www.addgene.org/48683

Genetic Insert: HIV Integrase
Vector Backbone Description: Vector Backbone:pET29a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23691126
Comments: The depositing lab recommends bacteria strain Rosetta (DE3)pLysS for protein expression. Please contact [email protected] for additional information about this plasmid.

Proper citation: RRID:Addgene_48683 Copy   


  • RRID:Addgene_48682

http://www.addgene.org/48682

Genetic Insert: PFV Integrase
Vector Backbone Description: Vector Backbone:pET29a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23691126
Comments: The depositing lab recommends bacteria strain Rosetta (DE3)pLysS for protein expression. Please contact [email protected] for additional information about this plasmid.

Proper citation: RRID:Addgene_48682 Copy   


  • RRID:Addgene_48718

http://www.addgene.org/48718

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Proper citation: RRID:Addgene_48718 Copy   


http://www.addgene.org/48799

Species: Mus musculus
Genetic Insert: ULK1
Vector Backbone Description: Backbone Marker:Sabatini lab; Backbone Size:7400; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23888043

Proper citation: RRID:Addgene_48799 Copy   


  • RRID:Addgene_48677

    This resource has 1+ mentions.

http://www.addgene.org/48677

Species: Synthetic
Genetic Insert: TAL binding site w/ GTCCCCTCCACCCCACAGTG protospacer, SP-PAM, and tdTomato reporter. Compatible with S. pyogenes Cas9
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48677 Copy   


  • RRID:Addgene_48798

    This resource has 1+ mentions.

http://www.addgene.org/48798

Species: Homo sapiens
Genetic Insert: YWHAZ
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12757707

Proper citation: RRID:Addgene_48798 Copy   


  • RRID:Addgene_48676

    This resource has 1+ mentions.

http://www.addgene.org/48676

Species: N. meningitidis
Genetic Insert: Cas9-VP64, nuclease-null
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48676 Copy   


  • RRID:Addgene_48797

    This resource has 1+ mentions.

http://www.addgene.org/48797

Species: Homo sapiens
Genetic Insert: YWHAE 14-3-3 ϵ
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12757707

Proper citation: RRID:Addgene_48797 Copy   


  • RRID:Addgene_48670

    This resource has 1+ mentions.

http://www.addgene.org/48670

Species: N. meningitidis
Genetic Insert: Cas9
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 hygro; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48670 Copy   


  • RRID:Addgene_48674

    This resource has 1+ mentions.

http://www.addgene.org/48674

Species: S. pyogenes
Genetic Insert: Cas9-VP64, nuclease-null
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48674 Copy   


  • RRID:Addgene_48672

    This resource has 1+ mentions.

http://www.addgene.org/48672

Species: Synthetic
Genetic Insert: sgRNA targeting GTCCCCTCCACCCCACAGTG, compatible with S. thermophilus #1 Cas9, hU6 promoter
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pCR-BluntII-TOPO; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48672 Copy   


  • RRID:Addgene_48709

    This resource has 1+ mentions.

http://www.addgene.org/48709

Species: Mus musculus
Genetic Insert: RORb
Vector Backbone Description: Vector Backbone:CBIG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: Please note that Addgene's sequencing results identified a few differences in the vector backbone when compared to the full plasmid sequence from the depositing laboratory. According to the depositor, these differences are not a concern for the function of the plasmid.

Proper citation: RRID:Addgene_48709 Copy   


  • RRID:Addgene_48666

http://www.addgene.org/48666

Species: Synthetic
Genetic Insert: TD prototspacer A/PAM with reporter EYFP
Vector Backbone Description: Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48666 Copy   


  • RRID:Addgene_48664

http://www.addgene.org/48664

Species: Synthetic
Genetic Insert: NM prototspacer A/PAM with reporter EYFP
Vector Backbone Description: Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48664 Copy   


  • RRID:Addgene_48669

    This resource has 1+ mentions.

http://www.addgene.org/48669

Species: S. thermophilus #1
Genetic Insert: Cas9
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48669 Copy   


  • RRID:Addgene_48789

http://www.addgene.org/48789

Genetic Insert: I-SceI
Vector Backbone Description: Vector Backbone:pmsg383; Vector Types:Bacterial Expression; Bacterial Resistance:Hygromycin
Defining Citation: PMID:21219454

Proper citation: RRID:Addgene_48789 Copy   


  • RRID:Addgene_48663

http://www.addgene.org/48663

Species: Synthetic
Genetic Insert: TD prototspacer B/PAM with reporter EYFP
Vector Backbone Description: Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48663 Copy   


  • RRID:Addgene_48661

http://www.addgene.org/48661

Species: Synthetic
Genetic Insert: SP/NM prototspacer B/PAM with reporter EYFP
Vector Backbone Description: Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24076762

Proper citation: RRID:Addgene_48661 Copy   


  • RRID:Addgene_48815

http://www.addgene.org/48815

Species: Synthetic
Genetic Insert: 35S promoter
Vector Backbone Description: Backbone Size:2686; Vector Backbone:pUC19; Vector Types:Golden Gate compatible cloning vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24376629
Comments: This plasmid is designed for Golden Gate cloning using the BsaI enzyme. Plasmid Features (listed as bp in full plasmid sequence): BsaI site #1 = 2241-2251bp 35S promoter = 2252-3115bp BsaI site #2 = 3116-3126bp

Proper citation: RRID:Addgene_48815 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X