Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Bacterial Resistance:ampicillin (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

328,630 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pET21d-colEdes15/Imdes15
 
Resource Report
Resource Website 		RRID:Addgene_107123 colEdes15/Imdes15 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes15: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKGANQRNIKQGQAPFAPKKDQVGGRKTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes15: MELKHSISDYTEAEFLEFVKEILEIQDEELQKIQVEEFERLTEHPDGSDLIYYPRDDRDDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes14/Imdes14
 
Resource Report
Resource Website 		RRID:Addgene_107122 colEdes14/Imdes14 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes14: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKRKFWEEVSKDPDLSKQFKGSNQNRIKQGQAPFARKKDQVGGRKTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes14: MELKHSISDYTEAEFLEFVKKICEGHFEAGSDGPKVVQEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pTRIPZ Myc2-mouse TTP WT
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107000 tristetraprolin Mus musculus Ampicillin PMID:29246442 Please note- Addgene's quality control found one “g” nucleotide missing from the insert sequence. The depositor noted this "g" should make no difference to the function of plasmid, since it is located within an intron and will be spliced out. Backbone Marker:Thermo Scientific; Vector Backbone:pTRIPZ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:05 1
pET21d-colEdes13/Imdes13
 
Resource Report
Resource Website 		RRID:Addgene_107121 colEdes13/Imdes13 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes13: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKRSNQNNIKQGIAPFARSKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes13: MELKHSISDYTEAEFLEFVKKIMASNDETQQRKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 0
pGL3 3'UTR reporter WT 1.3 kb CD274 Hs 3'UTR Final
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107009 CD274 Homo sapiens Ampicillin PMID:29246442 Backbone Marker:Promega; Vector Backbone:pGL3; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-08-15 01:01:05 3
pET15T-MsePCNA1
 
Resource Report
Resource Website 		RRID:Addgene_107063 M. sedula PCNA1 Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pUDP046
 
Resource Report
Resource Website 		RRID:Addgene_107062 HH-gRNA-HDV targetting OpKU80 inO. parapolymorpha Ogataea parapolymorpha Ampicillin PMID:29438517 Backbone Marker:Juergens H et al. Genome editing in Kluyveromyces and Ogataea yeasts using a broad-host-range Cas9/gRNA expression plasmid; Backbone Size:10046; Vector Backbone:pUDP002 #103872; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 0
K785R Smarca4-sfGFP
 
Resource Report
Resource Website 		RRID:Addgene_107057 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 Mus musculus Ampicillin PMID:29323272 Vector Backbone:pRRL; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin K785R 2026-08-15 01:01:06 0
pX601 miniCMV-SaCas9-SpA-sgRNA scaffold
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107055 Ampicillin Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 5
pMD-MsePCNA3
 
Resource Report
Resource Website 		RRID:Addgene_107075 M. sedula PCNA3 Synthetic Ampicillin PMID:27228945 Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pMD-MsePCNA2
 
Resource Report
Resource Website 		RRID:Addgene_107074 M. sedula PCNA2 Synthetic Ampicillin PMID:27228945 Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 0
pMD-MsePCNA1
 
Resource Report
Resource Website 		RRID:Addgene_107073 M. sedula PCNA1 Synthetic Ampicillin PMID:27228945 Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-YC
 
Resource Report
Resource Website 		RRID:Addgene_107072 YPet-CyPet fusion protein Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pLJM60 FLAG-RAB35 S22N
 
Resource Report
Resource Website 		RRID:Addgene_107106 RAB35 Homo sapiens Ampicillin PMID:26338797 Backbone Marker:Sabatini lab; Vector Backbone:pLJM60; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pLJM60 FLAG-RAB35 Q67L
 
Resource Report
Resource Website 		RRID:Addgene_107105 RAB35 Homo sapiens Ampicillin PMID:26338797 Backbone Marker:Sabatini lab; Vector Backbone:pLJM60; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin Q67L 2026-08-15 01:01:08 0
pMAL-SsoPCNA3
 
Resource Report
Resource Website 		RRID:Addgene_107069 S. solfataricus PCNA3 Synthetic Ampicillin PMID:27228945 Backbone Marker:New England Biolabs; Backbone Size:5670; Vector Backbone:pMAL-c5E; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET21d-colEdes2/Imdes2
 
Resource Report
Resource Website 		RRID:Addgene_107109 colEdes2/Imdes2 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWKEVAKDPDLAKQFKRANRRNIKQGRAPFAPKKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes2: MELKHSISDYTEAEFLEFVKKIYNSTDEEKQKELVTEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pGEX-6P-3-F37A+L196F+V252A+C253G-hADPRM
 
Resource Report
Resource Website 		RRID:Addgene_107163 F37A+L196F+V252A+C253G-hADPRM GST-mutant cADPR phosphohydrolase gene Synthetic Ampicillin PMID:29348648 Backbone Marker:GE Healthcare; Backbone Size:4946; Vector Backbone:pGEX-6P-3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:09 0
pBHt2G-RFP
 
Resource Report
Resource Website 		RRID:Addgene_107162 Ampicillin Golden-Gate compatible Magnaporthe oryzae Agrobacterium transformation vectors. Pennington HG, Youles M, Kamoun S. Figshare (2018) 10.6084/m9.figshare.5808348 Backbone Marker:Khang et al, 2010 http://www.plantcell.org/content/22/4/1388; Backbone Size:9617; Vector Backbone:pBHt2G; Vector Types:Fungal grobacterium transformation plasmid, tested in Magnaporthe; Bacterial Resistance:Ampicillin 2026-08-15 01:01:07 0
Flag-hPKL S113D
 
Resource Report
Resource Website 		RRID:Addgene_107161 Flag-hPKL S113D Homo sapiens Ampicillin PMID:31825824 Backbone Marker:Clontech; Backbone Size:6819; Vector Backbone:pLHCX; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin Serine 113 mutated to aspartate 2026-08-15 01:01:07 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch