Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Issues Status:no known issues (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

740,017 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
Nanog-2A-mCherry
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48680 Nanog Mus musculus Ampicillin PMID:23992847 Vector Backbone:pCR2.1TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:15:53 1
pLZL2372
 
Resource Report
Resource Website
RRID:Addgene_48683 HIV Integrase Kanamycin PMID:23691126 The depositing lab recommends bacteria strain Rosetta (DE3)pLysS for protein expression. Please contact [email protected] for additional information about this plasmid. Vector Backbone:pET29a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:15:53 0
pLZL2386
 
Resource Report
Resource Website
RRID:Addgene_48682 PFV Integrase Kanamycin PMID:23691126 The depositing lab recommends bacteria strain Rosetta (DE3)pLysS for protein expression. Please contact [email protected] for additional information about this plasmid. Vector Backbone:pET29a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:15:53 0
pTYB1-pLAC-N45
 
Resource Report
Resource Website
RRID:Addgene_48718 Lacritin Homo sapiens Ampicillin PMID:23640897 Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin Deleted first 45 amino acids of mature lacritin without signal peptide 2026-08-15 01:15:53 0
pLJM60 mUlk1 (wt) barcoded
 
Resource Report
Resource Website
RRID:Addgene_48799 ULK1 Mus musculus Ampicillin PMID:23888043 Backbone Marker:Sabatini lab; Backbone Size:7400; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:15:53 0
M-tdTom-SP
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48677 TAL binding site w/ GTCCCCTCCACCCCACAGTG protospacer, SP-PAM, and tdTomato reporter. Compatible with S. pyogenes Cas9 Synthetic Bleocin (Zeocin) PMID:24076762 Vector Backbone:Unknown; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin) 2026-08-15 01:15:53 2
pcDNA3.1-Myc-14-3-3ζ
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48798 YWHAZ Homo sapiens Ampicillin PMID:12757707 Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:15:53 2
M-NMn-VP64
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48676 Cas9-VP64, nuclease-null N. meningitidis Ampicillin PMID:24076762 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin nuclease-null 2026-08-15 01:15:52 5
pcDNA3.1-HA-14-3-3 ϵ
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48797 YWHAE 14-3-3 ϵ Homo sapiens Ampicillin PMID:12757707 Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:15:54 2
M-NMcas
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48670 Cas9 N. meningitidis Ampicillin PMID:24076762 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 hygro; Vector Types:CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:15:52 2
M-SPn-VP64
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48674 Cas9-VP64, nuclease-null S. pyogenes Ampicillin PMID:24076762 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin nuclease-null 2026-08-15 01:15:53 6
M-ST1-sgRNA
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48672 sgRNA targeting GTCCCCTCCACCCCACAGTG, compatible with S. thermophilus #1 Cas9, hU6 promoter Synthetic Kanamycin PMID:24076762 Backbone Marker:Invitrogen; Vector Backbone:pCR-BluntII-TOPO; Vector Types:CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:15:52 4
CBIG-RORb
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48709 RORb Mus musculus Ampicillin Please note that Addgene's sequencing results identified a few differences in the vector backbone when compared to the full plasmid sequence from the depositing laboratory. According to the depositor, these differences are not a concern for the function of the plasmid. Vector Backbone:CBIG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-08-15 01:15:53 1
SK-YFP-TD-A
 
Resource Report
Resource Website
RRID:Addgene_48666 TD prototspacer A/PAM with reporter EYFP Synthetic Kanamycin PMID:24076762 Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:15:52 0
SK-YFP-NM-A
 
Resource Report
Resource Website
RRID:Addgene_48664 NM prototspacer A/PAM with reporter EYFP Synthetic Kanamycin PMID:24076762 Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:15:52 0
M-ST1cas
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48669 Cas9 S. thermophilus #1 Ampicillin PMID:24076762 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:15:52 7
pRGM1
 
Resource Report
Resource Website
RRID:Addgene_48789 I-SceI Hygromycin PMID:21219454 Vector Backbone:pmsg383; Vector Types:Bacterial Expression; Bacterial Resistance:Hygromycin 2026-08-15 01:15:54 0
SK-YFP-TD-B
 
Resource Report
Resource Website
RRID:Addgene_48663 TD prototspacer B/PAM with reporter EYFP Synthetic Kanamycin PMID:24076762 Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:15:52 0
SK-YFP-SPNM-B
 
Resource Report
Resource Website
RRID:Addgene_48661 SP/NM prototspacer B/PAM with reporter EYFP Synthetic Kanamycin PMID:24076762 Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:15:52 0
pGGA004
 
Resource Report
Resource Website
RRID:Addgene_48815 35S promoter Synthetic Ampicillin PMID:24376629 This plasmid is designed for Golden Gate cloning using the BsaI enzyme. Plasmid Features (listed as bp in full plasmid sequence): BsaI site #1 = 2241-2251bp 35S promoter = 2252-3115bp BsaI site #2 = 3116-3126bp Backbone Size:2686; Vector Backbone:pUC19; Vector Types:Golden Gate compatible cloning vector; Bacterial Resistance:Ampicillin internal BsaI recognition site removed by substitution 2026-08-15 01:15:53 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.