Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 249 showing 4961 ~ 4980 out of 69,553 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection

http://www.addgene.org/178524

Species: Homo sapiens
Genetic Insert: PP1c-miRFP703
Vector Backbone Description: Backbone Size:4720; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34880255
Comments: The sequence and plasmid map is available in the following benchling link (https://benchling.com/s/seq-8370yYN7igj1pyuf3TeZ).

Proper citation: RRID:Addgene_178524 Copy   


  • RRID:Addgene_178480

http://www.addgene.org/178480

Species: Homo sapiens
Genetic Insert: MAD2L1_HORMA
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35044719
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.04.13.439572v1 for bioRxv preprint. Growth in BL21 DE3 gold 37 C after induction with 1mM IPTG 4 hours 30 C. Insert: GMALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND.

Proper citation: RRID:Addgene_178480 Copy   


  • RRID:Addgene_17843

    This resource has 10+ mentions.

http://www.addgene.org/17843

Species: Homo sapiens
Genetic Insert: YAP
Vector Backbone Description: Backbone Marker:CLONTECH; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12535517
Comments: This clone was generated by my postdoctoral felllow: Xavier Espanel.

Proper citation: RRID:Addgene_17843 Copy   


  • RRID:Addgene_17844

    This resource has 1+ mentions.

http://www.addgene.org/17844

Species: Homo sapiens
Genetic Insert: YAP
Vector Backbone Description: Backbone Marker:CLONTECH; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12535517
Comments: This clone was generated by my postdoctoral felllow: Akihiko Komuro.

Proper citation: RRID:Addgene_17844 Copy   


  • RRID:Addgene_178438

http://www.addgene.org/178438

Species: Homo sapiens
Genetic Insert: ZFP36
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178438 Copy   


  • RRID:Addgene_178459

    This resource has 1+ mentions.

http://www.addgene.org/178459

Species: Homo sapiens
Genetic Insert: GGA1
Vector Backbone Description: Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12686608
Comments: Please note: Plasmid contains a S434L mutation in GGA1 compared to the NCBI reference sequence NP_037497.1. This mutation is not known to affect plasmid function.

Proper citation: RRID:Addgene_178459 Copy   


  • RRID:Addgene_178451

    This resource has 1+ mentions.

http://www.addgene.org/178451

Species: Homo sapiens
Genetic Insert: BATF
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178451 Copy   


  • RRID:Addgene_178452

http://www.addgene.org/178452

Species: Homo sapiens
Genetic Insert: ZNF267
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178452 Copy   


  • RRID:Addgene_178444

http://www.addgene.org/178444

Species: Homo sapiens
Genetic Insert: LITAF
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178444 Copy   


  • RRID:Addgene_178442

http://www.addgene.org/178442

Species: Homo sapiens
Genetic Insert: CREM
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Comments: Please note: Plasmid encodes human CREM isoform 2.

Proper citation: RRID:Addgene_178442 Copy   


  • RRID:Addgene_178443

http://www.addgene.org/178443

Species: Homo sapiens
Genetic Insert: MXD1
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178443 Copy   


  • RRID:Addgene_178449

    This resource has 1+ mentions.

http://www.addgene.org/178449

Species: Homo sapiens
Genetic Insert: STAT2
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178449 Copy   


  • RRID:Addgene_178440

http://www.addgene.org/178440

Species: Homo sapiens
Genetic Insert: SUB1
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086

Proper citation: RRID:Addgene_178440 Copy   


http://www.addgene.org/178587

Species: Homo sapiens
Genetic Insert: NEUROD1-K139D
Vector Backbone Description: Backbone Size:4700; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34582787

Proper citation: RRID:Addgene_178587 Copy   


http://www.addgene.org/178585

Species: Homo sapiens
Genetic Insert: DLX2
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34582787

Proper citation: RRID:Addgene_178585 Copy   


http://www.addgene.org/178584

Species: Homo sapiens
Genetic Insert: NEUROD1
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34582787

Proper citation: RRID:Addgene_178584 Copy   


  • RRID:Addgene_17869

http://www.addgene.org/17869

Species: Homo sapiens
Genetic Insert: NFATc4
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10537109
Comments: Full-length human NFATc4

Proper citation: RRID:Addgene_17869 Copy   


  • RRID:Addgene_178659

http://www.addgene.org/178659

Species: Homo sapiens
Genetic Insert: A1-LCD -12F+12Y
Vector Backbone Description: Vector Backbone:pDEST17; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34931046

Proper citation: RRID:Addgene_178659 Copy   


  • RRID:Addgene_178674

http://www.addgene.org/178674

Species: Homo sapiens
Genetic Insert: A1-LCD+8D
Vector Backbone Description: Vector Backbone:pDEST17; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34931046

Proper citation: RRID:Addgene_178674 Copy   


  • RRID:Addgene_178678

http://www.addgene.org/178678

Species: Homo sapiens
Genetic Insert: A1-LCD+7R+12D
Vector Backbone Description: Vector Backbone:pDEST17; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34931046

Proper citation: RRID:Addgene_178678 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X