Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: PP1c-miRFP703
Vector Backbone Description: Backbone Size:4720; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34880255
Comments: The sequence and plasmid map is available in the following benchling link (https://benchling.com/s/seq-8370yYN7igj1pyuf3TeZ).
Proper citation: RRID:Addgene_178524 Copy
Species: Homo sapiens
Genetic Insert: MAD2L1_HORMA
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35044719
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.04.13.439572v1 for bioRxv preprint. Growth in BL21 DE3 gold 37 C after induction with 1mM IPTG 4 hours 30 C. Insert: GMALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND.
Proper citation: RRID:Addgene_178480 Copy
Species: Homo sapiens
Genetic Insert: YAP
Vector Backbone Description: Backbone Marker:CLONTECH; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12535517
Comments: This clone was generated by my postdoctoral felllow: Xavier Espanel.
Proper citation: RRID:Addgene_17843 Copy
Species: Homo sapiens
Genetic Insert: YAP
Vector Backbone Description: Backbone Marker:CLONTECH; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12535517
Comments: This clone was generated by my postdoctoral felllow: Akihiko Komuro.
Proper citation: RRID:Addgene_17844 Copy
Species: Homo sapiens
Genetic Insert: ZFP36
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178438 Copy
Species: Homo sapiens
Genetic Insert: GGA1
Vector Backbone Description: Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12686608
Comments: Please note: Plasmid contains a S434L mutation in GGA1 compared to the NCBI reference sequence NP_037497.1. This mutation is not known to affect plasmid function.
Proper citation: RRID:Addgene_178459 Copy
Species: Homo sapiens
Genetic Insert: BATF
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178451 Copy
Species: Homo sapiens
Genetic Insert: ZNF267
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178452 Copy
Species: Homo sapiens
Genetic Insert: LITAF
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178444 Copy
Species: Homo sapiens
Genetic Insert: CREM
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Comments: Please note: Plasmid encodes human CREM isoform 2.
Proper citation: RRID:Addgene_178442 Copy
Species: Homo sapiens
Genetic Insert: MXD1
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178443 Copy
Species: Homo sapiens
Genetic Insert: STAT2
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178449 Copy
Species: Homo sapiens
Genetic Insert: SUB1
Vector Backbone Description: Vector Backbone:pFUW-TetO; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35245086
Proper citation: RRID:Addgene_178440 Copy
Species: Homo sapiens
Genetic Insert: NEUROD1-K139D
Vector Backbone Description: Backbone Size:4700; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34582787
Proper citation: RRID:Addgene_178587 Copy
Species: Homo sapiens
Genetic Insert: DLX2
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34582787
Proper citation: RRID:Addgene_178585 Copy
Species: Homo sapiens
Genetic Insert: NEUROD1
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34582787
Proper citation: RRID:Addgene_178584 Copy
Species: Homo sapiens
Genetic Insert: NFATc4
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10537109
Comments: Full-length human NFATc4
Proper citation: RRID:Addgene_17869 Copy
Species: Homo sapiens
Genetic Insert: A1-LCD -12F+12Y
Vector Backbone Description: Vector Backbone:pDEST17; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34931046
Proper citation: RRID:Addgene_178659 Copy
Species: Homo sapiens
Genetic Insert: A1-LCD+8D
Vector Backbone Description: Vector Backbone:pDEST17; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34931046
Proper citation: RRID:Addgene_178674 Copy
Species: Homo sapiens
Genetic Insert: A1-LCD+7R+12D
Vector Backbone Description: Vector Backbone:pDEST17; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34931046
Proper citation: RRID:Addgene_178678 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.