Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: Synapsin I promoter
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P1-P5r; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21772812
Comments: Gene Therapy 14, 872-882 (June 2007) doi:10.1038/sj.gt.3302924
Efficient gene transduction of neurons by lentivirus with enhanced neuron-specific promoters
H Hioki, H Kameda, H Nakamura, T Okunomiya, K Ohira, K Nakamura, M Kuroda, T Furuta and T Kaneko
Proper citation: RRID:Addgene_32582 Copy
Genetic Insert: Intronic Luciferase miRNA and EGFP
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P3-P2; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21772812
Comments: LucmiRNA atttgtattcagcccatatcgg
Du, G., Yonekubo, J., Zeng, Y., Osisami, M., and Frohman, M. A. (2006). Design of expression vectors for RNA interference based on miRNAs and RNA splicing. FEBS J. 273, 5421–5427.
Proper citation: RRID:Addgene_32588 Copy
Genetic Insert: Intronic HCN1miRNA and EGFP
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P4r-P3r; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21772812
Comments: HCN1miRNA TAAAGACGACAGTAGGTATCAG
Du, G., Yonekubo, J., Zeng, Y., Osisami, M., and Frohman, M. A. (2006). Design of expression vectors for RNA interference based on miRNAs and RNA splicing. FEBS J. 273, 5421–5427.
Proper citation: RRID:Addgene_32586 Copy
Species: Homo sapiens
Genetic Insert: DCX
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pDsRed2-N1; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15173193
Proper citation: RRID:Addgene_32851 Copy
Species: Mus musculus
Genetic Insert: Talin 1 Rod aa 434-2541
Vector Backbone Description: Backbone Marker:BD Clontech; Backbone Size:4749; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17114441
Comments: Please note that both the full plasmid sequence from the depositing laboratory and Addgene's sequencing results indicate a K673N mutation/SNP when the sequences are compared to GenBank entry NP_035732.2. The depositing laboratory states that this difference is not a concern for the function of the plasmid. The most appropriate reference sequence for the Talin1 insert in the plasmid is GenBank accession number CAA39588.1.
Proper citation: RRID:Addgene_32855 Copy
Species: Homo sapiens
Genetic Insert: MLH1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3RBN. http://www.thesgc.org/structures/3RBN/
Proper citation: RRID:Addgene_32859 Copy
Species: Homo sapiens
Genetic Insert: Tyrosinase
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:10823941
Proper citation: RRID:Addgene_32781 Copy
Species: Homo sapiens
Genetic Insert: PANK1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26094); Vector Backbone:pET28a-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3SMP. http://www.thesgc.org/structures/3SMP/
Proper citation: RRID:Addgene_32871 Copy
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4672; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:9857032
Comments: To create the EGFR-GFP fusion (in-frame), the the full-length cDNA of EGFR including 3' and 5' untranslated regions was cloned into pEGFP-N1 as an XbaI/HindIII fragment. This is EGFR-wt. The 3' end of the EGFR cDNA including STOP codon and untranslated region was removed by PCR and digestion. The 3' primer generated a new SstII (SacII) site.
Proper citation: RRID:Addgene_32751 Copy
Species: Homo sapiens
Genetic Insert: HECTD1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 2LC3. http://www.thesgc.org/structures/2LC3/
Proper citation: RRID:Addgene_32860 Copy
Species: Toxoplasma gondii
Genetic Insert: MAPK2
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3RP9. http://www.thesgc.org/structures/3RP9/
Proper citation: RRID:Addgene_32862 Copy
Species: Homo sapiens
Genetic Insert: SETD1A
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3S8S. http://www.thesgc.org/structures/3S8S/
Proper citation: RRID:Addgene_32868 Copy
Species: Homo sapiens
Genetic Insert: TPK1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3S4Y. http://www.thesgc.org/structures/3S4Y/
Proper citation: RRID:Addgene_32865 Copy
Genetic Insert: GFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21558267
Comments: The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP.
Proper citation: RRID:Addgene_32748 Copy
Species: Homo sapiens
Genetic Insert: TDRD5
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3S93. http://www.thesgc.org/structures/3S93/
Proper citation: RRID:Addgene_32869 Copy
Species: Homo sapiens
Genetic Insert: SRF
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21415370
Proper citation: RRID:Addgene_32971 Copy
Species: Homo sapiens
Genetic Insert: Tbx5
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21415370
Proper citation: RRID:Addgene_32968 Copy
Species: Mus musculus
Genetic Insert: Nkx2-5
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21415370
Proper citation: RRID:Addgene_32969 Copy
Species: Homo sapiens
Genetic Insert: ATF6
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:11821395
Comments: During sequencing a change of Methionine 67 to Leucine, and Methionine 313 to Isoleucine was detected. This change in the basic region should not affect experiments with this construct, but could affect DNA binding by derivatives made from this plasmid.
Proper citation: RRID:Addgene_32956 Copy
Species: Homo sapiens
Genetic Insert: Histone H1.1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15911621
Proper citation: RRID:Addgene_32894 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
