Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pSLIK sh human Rb 1534 hyg Resource Report Resource Website 1+ mentions |
RRID:Addgene_31500 | RB shRNA | Homo sapiens | Ampicillin | The whole sequence for the shRNA including the loop should be from 3872-3931 in the vector: AGCGAAACGATTATCCATTCAAATAGTGAAGCCACAGATGTATTTGAAT The shRNA is downstream of the EGFP GGATAATCGTT pSLIK vector from Ian Frasier | Backbone Size:13700; Vector Backbone:pSLIK-EGFP; Vector Types:Mammalian Expression, Lentiviral, RNAi; Bacterial Resistance:Ampicillin | The target sequence for shRB 1534 is GAACGATTATCCATTCAAA | 2026-08-15 01:13:35 | 3 | |
|
pTRETightBI-RY-7 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31466 | eYFP and mCherry | fluorescent proteins | Ampicillin | PMID:21857679 | 7 tandem miR-20 binding sites in mCherry 3'UTR | Backbone Marker:Clontech; Backbone Size:2850; Vector Backbone:pTRETightBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:34 | 1 | |
|
pQStrep2-ARPC3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31580 | Actin related protein 2/3 complex, subunit 3 | Homo sapiens | Ampicillin | PMID:15998469 | The vector pQTEV is derived from Qiagen pQE-2 and contains an inactive chloramphenicol resistance gene sequence. Please note that Addgene's quality control sequence shows a small deletion in the vector region downstream of insert; the deletion does not affect any features in this construct. | Backbone Size:3460; Vector Backbone:pQStrep2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:33 | 1 | |
|
pLS1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31490 | lactose repressor protein | Ampicillin | PMID:11266612 | Parent plasmid was pEMBL9' with insert of extended LacI sequence from pIQ (Hare & Sadler, Gene 3 (1978) 269-278. For expression: E. coli BLIM cells (or any E. coli WITHOUT lactose repressor in the genome or accompanying plasmid) | Backbone Size:4540; Vector Backbone:pEMBL9'; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 2 | ||
|
pTARA Resource Report Resource Website 1+ mentions |
RRID:Addgene_31491 | RNA polymerase | T7 phage | Chloramphenicol | PMID:10610690 | For expression: E. coli CV2 N823D mutation should not affect plasmid function. | Backbone Size:5400; Vector Backbone:pBAD33; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol | N823D | 2026-08-15 01:13:33 | 5 |
|
pOVA Resource Report Resource Website 1+ mentions |
RRID:Addgene_31598 | OVA | Gallus gallus | Ampicillin | PMID:9364701 | *The backbone (TCAE) was modified to eliminate the immunoglobulin variable and constant regions, the neomycin resistance gene, and the DHFR gene. See paper for more details. | Backbone Marker:Reff et al., 1994; Backbone Size:9209; Vector Backbone:TCAE (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:33 | 2 | |
|
Snail_pGL2 Resource Report Resource Website 10+ mentions |
RRID:Addgene_31694 | Snail | Homo sapiens | Ampicillin | PMID:12705869 | Contains Snail promoter (-1045 to -56) sequence upstream of luciferase | Backbone Size:5598; Vector Backbone:pGL2_Basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:38 | 17 | |
|
pDEST40-MCU-V5-HIS Resource Report Resource Website 1+ mentions |
RRID:Addgene_31731 | MCU | Homo sapiens | Ampicillin | PMID:21685886 | Backbone Marker:Invitrogen; Backbone Size:5485; Vector Backbone:pDEST40-pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 4 | ||
|
SnailHA_pcDNA3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31697 | Snail | Homo sapiens | Ampicillin | PMID:15314165 | Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1+; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:38 | 5 | ||
|
GFP-Rab5 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31733 | Rab5 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:36 | 9 | ||
|
pcDNA3-ATR WT Resource Report Resource Website 10+ mentions |
RRID:Addgene_31611 | ATR | Homo sapiens | Ampicillin | PMID:16354678 | Plasmid contains an R1631H polymorphism. This is not thought to affect plasmid function. | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 12 | |
|
pDEST47-MCU-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_31732 | MCU | Homo sapiens | Ampicillin | PMID:21685886 | *A2T aa residue substitution in MCU, which is not known to affect protein function | Backbone Marker:Invitrogen (Cat#V355-20); Backbone Size:5784; Vector Backbone:pcDNA6.2/C-EmGFP-DEST; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | * | 2026-08-15 01:13:39 | 7 |
|
GFP-Rab8 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31735 | Rab8 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:39 | 3 | ||
|
GFP-Rab6 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31734 | Rab6 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | ||
|
GFP-Rab10 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31737 | Rab10 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | ||
|
pRK5F-ALK5-HA(ecto) Resource Report Resource Website 1+ mentions |
RRID:Addgene_31720 | ALK5 | Homo sapiens | Ampicillin | This construct is beginning from a Signal Peptide of human TbRI/ALK5, followed by a HA tag, the extracellular cDNA sequence of human TbRI/ALK, and ended by a Flag tag. This vector to produces a secreted TbRI/ALK5 extracellular form, with two individual tags on each side. | Backbone Size:4716; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:36 | 1 | ||
|
LZRS-Rfa Resource Report Resource Website 1+ mentions |
RRID:Addgene_31601 | Chloramphenicol and Ampicillin | PMID:15342384 | Backbone Marker:Khavari Lab; Backbone Size:11100; Vector Backbone:LZRS-RfA; Vector Types:Retroviral; Bacterial Resistance:Chloramphenicol and Ampicillin | 2026-08-15 01:13:37 | 5 | ||||
|
BoNT/A-LC Resource Report Resource Website 1+ mentions |
RRID:Addgene_31602 | BoNT/A LC | Ampicillin | PMID:18940613 | The author states that although the construct is from a toxic protein, it only contains one third of the biologically active protein,i.e., it is inactive and harmless per se, and it does not require BL4 level for its expression/manipulation. Toxic BoNT/A is made of two 'chains' (i.e. polypeptides) linked to each other by one disulfide bond. The light chain (LC) is 50KDa long, whereas the heavy chain (HC) is 100 KDa. The HC is necessary for the toxin to target and enter motorneurons. This construct is the LC of BoNTA, and it completely lacks the HC, so it is unable to intoxicate neurons. Protein sequence of BoNT/A fragment present in this plasmid (corresponds to YP_001386738.1) MSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT Nucleotide sequence of BoNT/A fragment present in this plasmid based on Addgene's Sanger sequencing results: ATGAGTGGGTTAGAAGTAAGCTTTGAGGAACTTAGAACATTTGGGGGACATGATGCAAAGTTTATAGATAGTTTACAGGAAAACGAATTTCGTCTATATTATTATAATAAGTTTAAAGATATAGCAAGTACACTTAATAAAGCTAAATCAATAGTAGGTACTACTGCTTCATTACAGTATATGAAAAATGTTTTTAAAGAGAAATATCTCCTATCTGAAGATACATCTGGAAAATTTTCGGTAGATAAATTAAAATTTGATAAGTTATACAAAATGTTAACAGAGATTTACACAGAGGATAATTTTGTTAAGTTTTTTAAAGTACTTAACAGAAAAACATATTTGAATTTTGATAAAGCCGTATTTAAGATAAATATAGTACCTAAGGTAAATTACACAATATATGATGGATTTAATTTAAGAAATACAAATTTAGCAGCAAACTTTAATGGTCAAAATACAGAAATTAATAATATGAATTTTACTAAACTAAAAAATTTTACT | Backbone Size:0; Vector Backbone:pBN3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | ||
|
pDONR223-MCU Resource Report Resource Website 1+ mentions |
RRID:Addgene_31726 | MCU | Homo sapiens | Spectinomycin | PMID:21685886 | *A3T aa residue substitution in MCU, which is not known to affect protein function | Backbone Marker:Invitrogen; Backbone Size:2787; Vector Backbone:pDONR223; Vector Types:pDONR Gateway; Bacterial Resistance:Spectinomycin | * | 2026-08-15 01:13:39 | 1 |
|
pKin1A Resource Report Resource Website 1+ mentions |
RRID:Addgene_31607 | kinesin-1A | Mus musculus | Kanamycin | PMID:19812246 | Backbone Marker:Clontech; Backbone Size:3940; Vector Backbone:pEGFP-C1 (EGFP removed); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:38 | 4 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
