Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: sgRNA1 targeting Mboat2
Vector Backbone Description: Vector Backbone:LentiCrispr V2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:42525742
Proper citation: RRID:Addgene_258333 Copy
Species: Mus musculus
Genetic Insert: Mboat2
Vector Backbone Description: Backbone Marker:VectorBuilder; Vector Backbone:pLV; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:42525742
Proper citation: RRID:Addgene_258331 Copy
Species: Mus musculus
Genetic Insert: sgRNA1 targeting Elovl5
Vector Backbone Description: Vector Backbone:LentiCrispr V2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:42525742
Proper citation: RRID:Addgene_258337 Copy
Species: Mus musculus
Genetic Insert: sgRNA2 targeting Mboat2
Vector Backbone Description: Vector Backbone:LentiCrispr V2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:42525742
Proper citation: RRID:Addgene_258336 Copy
Species: Mus musculus
Genetic Insert: gRNA1, gRNA2, Fusion Red
Vector Backbone Description: Backbone Marker:Virovek; Backbone Size:4866; Vector Backbone:pFB; Vector Types:Mammalian Expression, AAV, CRISPR, pFB; Bacterial Resistance:Ampicillin
Comments: Please visit https://doi.org/10.64898/2026.06.17.732978 for bioRxiv preprint.
Proper citation: RRID:Addgene_258848 Copy
Species: Mus musculus
Genetic Insert: Ezh2[SET]
Vector Backbone Description: Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28973434
Proper citation: RRID:Addgene_100087 Copy
Species: Mus musculus
Genetic Insert: 14056
Vector Backbone Description: Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28973434
Proper citation: RRID:Addgene_100086 Copy
Species: Mus musculus
Genetic Insert: Talin 1 Rod aa 434-2541
Vector Backbone Description: Backbone Marker:BD Clontech; Backbone Size:4749; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17114441
Comments: Please note that both the full plasmid sequence from the depositing laboratory and Addgene's sequencing results indicate a K673N mutation/SNP when the sequences are compared to GenBank entry NP_035732.2. The depositing laboratory states that this difference is not a concern for the function of the plasmid. The most appropriate reference sequence for the Talin1 insert in the plasmid is GenBank accession number CAA39588.1.
Proper citation: RRID:Addgene_32855 Copy
Species: Mus musculus
Genetic Insert: Kir2.1-mCherry
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P5-P2; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21772812
Proper citation: RRID:Addgene_32669 Copy
Species: Mus musculus
Genetic Insert: solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5600; Vector Backbone:pcDNA3.1/Hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11457730
Proper citation: RRID:Addgene_32705 Copy
Species: Mus musculus
Genetic Insert: CREB
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9447994
Comments: A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.
Proper citation: RRID:Addgene_33371 Copy
Species: Mus musculus
Genetic Insert: Cebpb
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: This is the dominant negative Cebpb- which contains an N-terminal acidic extension (LEQRAEELARENEELEKEAEELEQENAE) fused to the HLH-ZIP region of Cebpb.
Proper citation: RRID:Addgene_33363 Copy
Species: Mus musculus
Genetic Insert: FGFR2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10851026
Proper citation: RRID:Addgene_33249 Copy
Species: Mus musculus
Genetic Insert: NFIL-3
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5597; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21566115
Proper citation: RRID:Addgene_34572 Copy
Species: Mus musculus
Genetic Insert: ATF
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: This is the dominant negative ATF- which contains an N-terminal acidic extension fused to the HLH-ZIP region of ATF.
Proper citation: RRID:Addgene_33362 Copy
Species: Mus musculus
Genetic Insert: Arg1 promoter/enhancer -31/-3810
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15187136
Proper citation: RRID:Addgene_34571 Copy
Species: Mus musculus
Genetic Insert: Arg1 base promoter -31/-2365
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15187136
Proper citation: RRID:Addgene_34570 Copy
Species: Mus musculus
Genetic Insert: FOS
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9447994
Comments: Acidic amphipathic extension added to the Fos leucine zipper: LEQRAEELARENEELEKEAEELEQELAE
Although the acidic extension is to the c-Fos leucine zipper, A-Fos heterodimerizes and inhibits c-Jun.
Proper citation: RRID:Addgene_33353 Copy
Species: Mus musculus
Genetic Insert: Hsp68 promoter
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:2800; Vector Backbone:pBluescript; Vector Types:Mammalian Expression, Mouse Targeting; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12915490
Comments: For more information about this plasmid see attached information sheet.
Proper citation: RRID:Addgene_33351 Copy
Species: Mus musculus
Genetic Insert: Sirt3
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20235147
Comments: This is the short form, lacking the 63 aa N-terminal aa included in the long form.
Proper citation: RRID:Addgene_33310 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
