Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: Human NRP1 b1 domain residues 273-427
Vector Backbone Description: Vector Backbone:pET-28a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33082294
Proper citation: RRID:Addgene_162734 Copy
Species: Homo sapiens
Genetic Insert: FKBP F36V
Vector Backbone Description: Vector Backbone:pUC ori vector, pX330-U6-Chimeric_BB-CBh-hSpCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33376784
Proper citation: RRID:Addgene_162726 Copy
Species: Homo sapiens
Genetic Insert: 8x of NFAT binding motif follwed by ZsGreen-1 fluorescent protein gene
Vector Backbone Description: Backbone Marker:Maki Nakayama; Vector Backbone:pSIR; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33841327
Comments: Second gene is mutated human CD4
Proper citation: RRID:Addgene_162745 Copy
Species: Homo sapiens
Genetic Insert: hTRF1
Vector Backbone Description: Backbone Size:5900; Vector Backbone:pWZL Hygro NFLAG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12169636
Proper citation: RRID:Addgene_16278 Copy
Species: Homo sapiens
Genetic Insert: hTRF1
Vector Backbone Description: Backbone Size:5900; Vector Backbone:pWZL Hygro NFLAG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12169636
Proper citation: RRID:Addgene_16277 Copy
Species: Homo sapiens
Genetic Insert: BsmBI_(C1A)-Intein_DD
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Proper citation: RRID:Addgene_162811 Copy
Species: Homo sapiens
Genetic Insert: SMIM38(C-TAG)-Intein-DD
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD(TAG) - UniProtKB - A0A286YFK9 (SIM38_HUMAN)
Proper citation: RRID:Addgene_162814 Copy
Species: Homo sapiens
Genetic Insert: Ub-BsmBI_IRES_Blasticidin
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Proper citation: RRID:Addgene_162804 Copy
Species: Homo sapiens
Genetic Insert: hTRF1
Vector Backbone Description: Backbone Size:5900; Vector Backbone:pWZL Hygro NFLAG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12169636
Proper citation: RRID:Addgene_16281 Copy
Species: Homo sapiens
Genetic Insert: human Glucose response protein 78 promoter
Vector Backbone Description: Vector Backbone:pDonr231; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24395366
Proper citation: RRID:Addgene_162970 Copy
Species: Homo sapiens
Genetic Insert: human pGK promoter
Vector Backbone Description: Vector Backbone:pDonr215; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24395366
Proper citation: RRID:Addgene_162976 Copy
Species: Homo sapiens
Genetic Insert: human EF1alpha promoter
Vector Backbone Description: Vector Backbone:pDonr215; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24395366
Proper citation: RRID:Addgene_162975 Copy
Species: Homo sapiens
Genetic Insert: methyltransferase like 3
Vector Backbone Description: Backbone Size:8762; Vector Backbone:Tet-pLKO-puro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088870
Proper citation: RRID:Addgene_162985 Copy
Species: Homo sapiens
Genetic Insert: methyltransferase like 3
Vector Backbone Description: Backbone Size:8762; Vector Backbone:Tet-pLKO-puro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088870
Proper citation: RRID:Addgene_162984 Copy
Species: Homo sapiens
Genetic Insert: human pGK promoter
Vector Backbone Description: Vector Backbone:pDonr233; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366
Proper citation: RRID:Addgene_162921 Copy
Species: Homo sapiens
Genetic Insert: SV40 immediate early promoter
Vector Backbone Description: Vector Backbone:pDonr233; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366
Proper citation: RRID:Addgene_162923 Copy
Species: Homo sapiens
Genetic Insert: human Ubiquitin C promoter
Vector Backbone Description: Vector Backbone:pDonr233; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366
Proper citation: RRID:Addgene_162925 Copy
Species: Homo sapiens
Genetic Insert: WWTR1
Vector Backbone Description: Vector Backbone:pKLV2-U6gRNA5(BbsI)-PGKpuro2AmCherry-W; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32990596
Proper citation: RRID:Addgene_163176 Copy
Species: Homo sapiens
Genetic Insert: YAP1
Vector Backbone Description: Vector Backbone:pKLV2-U6gRNA5(BbsI)-PGKpuro2AmCherry-W; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32990596
Proper citation: RRID:Addgene_163179 Copy
Species: Homo sapiens
Genetic Insert: tau
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5370; Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:9169052
Comments: For bacterial expression of human tau T40.
Proper citation: RRID:Addgene_16316 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.