Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
μ2-HA-WT Resource Report Resource Website 1+ mentions |
RRID:Addgene_32752 | μ2 subunit of clathrin adaptor complex AP-2 | Rattus norvegicus | Ampicillin | PMID:10228163 | NB: The HA tag (YPYDVPDYALE) was inserted within the protein, between residues 236 and 237. | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:49 | 6 | |
|
SAFB1-pcDNA3.1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32742 | SAFB1 | Homo sapiens | Ampicillin | PMID:12660241 | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:44 | 1 | ||
|
PP-MAPK2 (3RP9) Resource Report Resource Website 1+ mentions |
RRID:Addgene_32862 | MAPK2 | Toxoplasma gondii | Kanamycin | PDB: 3RP9. http://www.thesgc.org/structures/3RP9/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | amino acids 123-548 only, P421L | 2026-08-15 01:13:44 | 1 | |
|
SETD1A Resource Report Resource Website 1+ mentions |
RRID:Addgene_32868 | SETD1A | Homo sapiens | Kanamycin | PDB: 3S8S. http://www.thesgc.org/structures/3S8S/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:44 | 1 | ||
|
pCAGFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_32748 | GFP | Kanamycin | PMID:21558267 | The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP. | Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | S65T | 2026-08-15 01:13:49 | 3 | |
|
pT-CA-GFP-IRES-mLumin Resource Report Resource Website 1+ mentions |
RRID:Addgene_32749 | CA-GFP | Ampicillin | PMID:21558267 | CA-GFP sequence is GFP fused with DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C-terminus | Backbone Marker:Dr. Alfred George, Vanderbilt University; Vector Backbone:pT-CD8-IRES-SCN2B; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | S65T | 2026-08-15 01:13:44 | 1 | |
|
pEntr-SRFflbio Resource Report Resource Website 1+ mentions |
RRID:Addgene_32971 | SRF | Homo sapiens | Kanamycin | PMID:21415370 | Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:45 | 1 | ||
|
pBABE-2XFLAG,2XHA-CyclinF-puro Resource Report Resource Website 1+ mentions |
RRID:Addgene_32976 | CYCLIN F | Homo sapiens | Ampicillin | PMID:20596027 | Backbone Marker:Weinberg Lab; Backbone Size:5200; Vector Backbone:pBABE-puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 1 | ||
|
p3XFlag-CMV10-Flag-mMcl-1 KR Resource Report Resource Website 1+ mentions |
RRID:Addgene_32979 | Mcl-1 | Mus musculus | Ampicillin | PMID:20385764 | Backbone Marker:Sigma; Backbone Size:6307; Vector Backbone:p3XFlag-CMV10; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | All lys changed to Arg | 2026-08-15 01:13:45 | 3 | |
|
pCGN-MEF2D Resource Report Resource Website 1+ mentions |
RRID:Addgene_32963 | MEF2D | Mus musculus | Ampicillin | Backbone Marker:M. Tanaka; Backbone Size:7500; Vector Backbone:pCGN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | E287G | 2026-08-15 01:13:45 | 1 | ||
|
3XMEF2-luc Resource Report Resource Website 10+ mentions |
RRID:Addgene_32967 | MEF2 binding sites | Homo sapiens | Ampicillin | This plasmid was cloned from pFOS WT-GL3 (Addgene #11983), where the human c-fos promoter was removed and replaced with 4 MEF2 sites. See author's map for restriction site/MCS details. | Backbone Marker:Promega; Backbone Size:5000; Vector Backbone:pGL3-promoter modified; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:51 | 19 | ||
|
pEntr-Tbx5flbio Resource Report Resource Website 1+ mentions |
RRID:Addgene_32968 | Tbx5 | Homo sapiens | Kanamycin | PMID:21415370 | Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:45 | 2 | ||
|
pEntr-Nkx2-5flbio Resource Report Resource Website 1+ mentions |
RRID:Addgene_32969 | Nkx2-5 | Mus musculus | Kanamycin | PMID:21415370 | Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:45 | 1 | ||
|
pGCDNsam-Hnf4a Resource Report Resource Website 1+ mentions |
RRID:Addgene_33002 | hepatic nuclear factor 4 alpha | Mus musculus | Ampicillin | PMID:21716291 | Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:51 | 4 | ||
|
pGCDNsam-Foxa1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_33003 | forkhead box A1 | Mus musculus | Ampicillin | PMID:21716291 | Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 2 | ||
|
pACAGW-H2B-PAGFP-AAV Resource Report Resource Website 1+ mentions |
RRID:Addgene_33000 | H2B-PAGFP | Homo sapiens | Ampicillin | PMID:22144948 | Plasmid containing the H2B-PAGFP fusion gene was a gift from André Nussenzweig (Kruhlak et al., 2006). The H2B-PAGFP gene was subcloned into the pACAGW-ChR2-Venus-AAV plasmid (Addgene # 20071). Kruhlak, M. J., Celeste, A., Dellaire, G., Fernandez-Capetillo, O., Müller, W. G., McNally, J. G., Bazett-Jones, D. P., and Nussenzweig, A. (2006). Changes in chromatin structure and mobility in living cells at sites of DNA double-strand breaks. J. Cell Biol. 172, 823-34. There is a 5bp deletion in Addgene's sequence compared to depositor's reference sequence. The deletion is in the vector sequence upstream of the ORF and does not affect plasmid function. There is also a mutation D26G in H2B; this mutation is found in depositor's reference sequence as well. | Backbone Size:4771; Vector Backbone:N/A; Vector Types:Mammalian Expression, AAV, adeno associated virus; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 3 | |
|
pGCDNsam-Hnf4a-IRES-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33006 | hepatic nuclear factor 4 alpha | Mus musculus | Ampicillin | PMID:21716291 | Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 3 | ||
|
pEGFP-ATF6-(S1P-) Resource Report Resource Website 1+ mentions |
RRID:Addgene_32956 | ATF6 | Homo sapiens | Kanamycin | PMID:11821395 | During sequencing a change of Methionine 67 to Leucine, and Methionine 313 to Isoleucine was detected. This change in the basic region should not affect experiments with this construct, but could affect DNA binding by derivatives made from this plasmid. | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | S1Protease site mutation: R415A/R416A | 2026-08-15 01:13:45 | 2 |
|
pGCDNsam-Foxa2-IRES-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_33008 | forkhead box A2 | Mus musculus | Ampicillin | PMID:21716291 | Vector Backbone:pGCDNsam; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:51 | 1 | ||
|
pCGN-S2P-WT Resource Report Resource Website 1+ mentions |
RRID:Addgene_32957 | S2P | Homo sapiens | Ampicillin | PMID:12110171 | Backbone Marker:M. Tanaka; Backbone Size:7500; Vector Backbone:pCGN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:45 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
