Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: p97
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27753622
Comments: Addgene NGS results found the addition of amino acids GSTGSR at the C-terminus of the p97 translation
Proper citation: RRID:Addgene_85670 Copy
Species: Rattus norvegicus
Genetic Insert: p97
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27753622
Comments: Addgene NGS results found the addition of amino acids GSTGSR at the C-terminus of the p97 translation
Proper citation: RRID:Addgene_85672 Copy
Species: Rattus norvegicus
Genetic Insert: SLC6A4 Serotonin Transporter
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17698848
Proper citation: RRID:Addgene_190174 Copy
Species: Rattus norvegicus
Genetic Insert: 3x-NLS-mScarlet-AMPKalpha2
Vector Backbone Description: Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35790710
Proper citation: RRID:Addgene_192452 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.
Proper citation: RRID:Addgene_177407 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170653 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170654 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170652 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170650 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170647 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170645 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:pGEX-4T; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170643 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:FUGW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170640 Copy
Species: Rattus norvegicus
Genetic Insert: SYT1
Vector Backbone Description: Vector Backbone:FUGW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32362337
Proper citation: RRID:Addgene_170641 Copy
Species: Rattus norvegicus
Genetic Insert: RPL18Bp-Neon(gfp)-Link-2xPH(PLCd)
Vector Backbone Description: Vector Backbone:pYTK089 (ColE1, AmpR); Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35708612
Comments: Part of the Markerless Yeast Localization and Overexpression (MyLO) CRISPR-Cas9 Toolkit. Vector cloned using BsaI Golden Gate cloning
Proper citation: RRID:Addgene_179038 Copy
Species: Rattus norvegicus
Genetic Insert: RPL18Bp-Scarlet(rfp)-Link-2xPH(PLCd)
Vector Backbone Description: Vector Backbone:pYTK089 (ColE1, AmpR); Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35708612
Comments: Part of the Markerless Yeast Localization and Overexpression (MyLO) CRISPR-Cas9 Toolkit. Vector cloned using BsaI Golden Gate cloning
Proper citation: RRID:Addgene_179059 Copy
Species: Rattus norvegicus
Genetic Insert: APOBEC1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3943; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_167169 Copy
Species: Rattus norvegicus
Genetic Insert: H2B-mIFP-T2A-rTetR-KRAB
Vector Backbone Description: Vector Backbone:pPB (PiggyBac); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35678392
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.11.04.467237v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_179438 Copy
Species: Rattus norvegicus
Genetic Insert: iLID mCherry iTrkA
Vector Backbone Description: Backbone Size:3900; Vector Backbone:pEGFP N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32335036
Proper citation: RRID:Addgene_136509 Copy
Species: Rattus norvegicus
Genetic Insert: iLID mRuby3 iTrkA
Vector Backbone Description: Backbone Size:3900; Vector Backbone:pEGFP N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32335036
Proper citation: RRID:Addgene_136510 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
