Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pENTR.hU6hH1 Resource Report Resource Website |
RRID:Addgene_32686 | Kanamycin | PMID:21418658 | Backbone Marker:Invitrogen; Backbone Size:2720; Vector Backbone:pENTR4; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:43 | 0 | ||||
|
pENTR-R4r-ECFP-R3r Resource Report Resource Website |
RRID:Addgene_32594 | ECFP | Kanamycin | PMID:21772812 | Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P4r-P3r; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:42 | 0 | |||
|
pENTR-L3-IRES-EGFP-L2 Resource Report Resource Website |
RRID:Addgene_32591 | IRES-EGFP | Kanamycin | PMID:21772812 | BMC Biotechnol. 2006 Jan 12;6:4. Development of a new bicistronic retroviral vector with strong IRES activity. Martin P, Albagli O, Poggi MC, Boulukos KE, Pognonec P. Source CNRS UMR6548, Parc Valrose, Université de Nice Sophia Antipolis, Nice, France. [email protected] | Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P3-P2; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:42 | 0 | ||
|
pENTR-L1-SYN-R5 Resource Report Resource Website |
RRID:Addgene_32582 | Synapsin I promoter | Homo sapiens | Kanamycin | PMID:21772812 | Gene Therapy 14, 872-882 (June 2007) doi:10.1038/sj.gt.3302924 Efficient gene transduction of neurons by lentivirus with enhanced neuron-specific promoters H Hioki, H Kameda, H Nakamura, T Okunomiya, K Ohira, K Nakamura, M Kuroda, T Furuta and T Kaneko | Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P1-P5r; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:42 | 0 | |
|
pENTR-L3-LucmiR-EGFP-L2 Resource Report Resource Website |
RRID:Addgene_32588 | Intronic Luciferase miRNA and EGFP | Kanamycin | PMID:21772812 | LucmiRNA atttgtattcagcccatatcgg Du, G., Yonekubo, J., Zeng, Y., Osisami, M., and Frohman, M. A. (2006). Design of expression vectors for RNA interference based on miRNAs and RNA splicing. FEBS J. 273, 5421–5427. | Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P3-P2; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:47 | 0 | ||
|
pENTR-R4r-HCN1miR-EGFP-R3r Resource Report Resource Website |
RRID:Addgene_32586 | Intronic HCN1miRNA and EGFP | Kanamycin | PMID:21772812 | HCN1miRNA TAAAGACGACAGTAGGTATCAG Du, G., Yonekubo, J., Zeng, Y., Osisami, M., and Frohman, M. A. (2006). Design of expression vectors for RNA interference based on miRNAs and RNA splicing. FEBS J. 273, 5421–5427. | Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P4r-P3r; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:42 | 0 | ||
|
MLH1 Resource Report Resource Website |
RRID:Addgene_32859 | MLH1 | Homo sapiens | Kanamycin | PDB: 3RBN. http://www.thesgc.org/structures/3RBN/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | contains amino acids 486-751 | 2026-08-15 01:13:49 | 0 | |
|
PANK1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32871 | PANK1 | Homo sapiens | Kanamycin | PDB: 3SMP. http://www.thesgc.org/structures/3SMP/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26094); Vector Backbone:pET28a-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | amino acids 231-597 only | 2026-08-15 01:13:44 | 1 | |
|
HECTD1 Resource Report Resource Website |
RRID:Addgene_32860 | HECTD1 | Homo sapiens | Kanamycin | PDB: 2LC3. http://www.thesgc.org/structures/2LC3/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | amino acids 1879-1966 only | 2026-08-15 01:13:44 | 0 | |
|
PP-MAPK2 (3RP9) Resource Report Resource Website 1+ mentions |
RRID:Addgene_32862 | MAPK2 | Toxoplasma gondii | Kanamycin | PDB: 3RP9. http://www.thesgc.org/structures/3RP9/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | amino acids 123-548 only, P421L | 2026-08-15 01:13:44 | 1 | |
|
SETD1A Resource Report Resource Website 1+ mentions |
RRID:Addgene_32868 | SETD1A | Homo sapiens | Kanamycin | PDB: 3S8S. http://www.thesgc.org/structures/3S8S/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:44 | 1 | ||
|
TPK1 Resource Report Resource Website |
RRID:Addgene_32865 | TPK1 | Homo sapiens | Kanamycin | PDB: 3S4Y. http://www.thesgc.org/structures/3S4Y/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:44 | 0 | ||
|
pCAGFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_32748 | GFP | Kanamycin | PMID:21558267 | The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP. | Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | S65T | 2026-08-15 01:13:49 | 3 | |
|
TDRD5 Resource Report Resource Website |
RRID:Addgene_32869 | TDRD5 | Homo sapiens | Kanamycin | PDB: 3S93. http://www.thesgc.org/structures/3S93/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:44 | 0 | ||
|
Venus Cam KII alpha mutant T286D Resource Report Resource Website 1+ mentions |
RRID:Addgene_29429 | Venus CAM KII Alpha | Mus musculus | Kanamycin | PMID:19339497 | Backbone Size:3984; Vector Backbone:pEGFP C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | T286D mutation in CamKIIa sequence | 2026-08-15 01:13:17 | 1 | |
|
CamKII alpha Venus Resource Report Resource Website 1+ mentions |
RRID:Addgene_29427 | Venus CamKII alpha | Mus musculus | Kanamycin | PMID:19339497 | Backbone Size:3984; Vector Backbone:pEGFP N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:19 | 5 | ||
|
V17V Resource Report Resource Website 1+ mentions |
RRID:Addgene_29424 | Venus-17-Venus | Kanamycin | PMID:19339497 | Anisotropy standard and brightness standard Linker sequence: TCCGGACTCAGATCTCGAGCTCAAGCTTCGAATTCTGCAGTCGACGGTACCAGCAAGG | Backbone Size:3984; Vector Backbone:pEGFP C1; Vector Types:Mammalian Expression, Anisotropy and brightness standard; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:19 | 3 | ||
|
pCMV-Tag4A-MMP8 (P78S) Resource Report Resource Website |
RRID:Addgene_29546 | Metalloproteinase protein 8 | Homo sapiens | Kanamycin | PMID:19330028 | Backbone Marker:Stratagene; Backbone Size:4300; Vector Backbone:pCMV-Tag4A; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin | P78S | 2026-08-15 01:13:18 | 0 | |
|
pMX155 Resource Report Resource Website 1+ mentions |
RRID:Addgene_29481 | Kif2A-alpha | Mus musculus | Kanamycin | PMID:15883193 | Depositor believes the mutation in Kif2a is the results of either errors in database sequences or polymorphisms. | Backbone Marker:Clontech; Backbone Size:4706; Vector Backbone:PEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | E140K | 2026-08-15 01:13:20 | 1 |
|
pET His6 MBP prescission LIC cloning vector (HMPKS) Resource Report Resource Website 1+ mentions |
RRID:Addgene_29721 | None | Kanamycin | This plasmid is an empty vector. Your gene can be inserted with a SLIC cloning protocol. Prescission is a highly specific protease that cleaves LEVLFQ/GP. It is generally more active than TEV protease, and many users have found that when their protein inhibits TEV cleavage, switching to a prescission vector has proved worthwhile. To clone into this vector, add SLIC tags to the 5' end of your PCR primers. Forward - 5'GTGCTGTTCCAGGGTCCGAAT3' Reverse - 5'TGGTGGTGGTGGTGCTCGA(TTA)3' Linearize the plasmid with SspI and XhoI, then gel purify. There is a 1650 bp stuffer sequence that will be visible on a gel. When digesting the DNA with T4 polymerase, use no nucleotides for either your insert or the linearized vector. More information on this vector can be found through http://qb3.berkeley.edu/qb3/macrolab/ | Backbone Size:8106; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:23 | 4 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
