Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Other
Genetic Insert: GFP
Vector Backbone Description: Vector Backbone:TtGNN (TREtight-cDNA-PGK-Neo); Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29316427
Proper citation: RRID:Addgene_106380 Copy
Species: Other
Genetic Insert: CjCas9
Vector Backbone Description: Backbone Marker:derived from pX551 (Addgene#60957); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107035 Copy
Species: Other
Genetic Insert: AsCpf1
Vector Backbone Description: Backbone Marker:derived from pX551 (Addgene#60957); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107034 Copy
Species: Other
Genetic Insert: CjCas9
Vector Backbone Description: Backbone Marker:derived from pX551 (Addgene#60957); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107033 Copy
Species: Other
Genetic Insert: SpCas9
Vector Backbone Description: Backbone Marker:derived from pX551 (Addgene#60957); Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107024 Copy
Species: Other
Genetic Insert: miniTurbo (BirA mutant)
Vector Backbone Description: Vector Backbone:pRS415; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107168 Copy
Species: Other
Genetic Insert: TurboID (BirA mutant)
Vector Backbone Description: Vector Backbone:pRS415; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107167 Copy
Species: Other
Genetic Insert: colEwt2/Imwt2
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEwt2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKGSNKTNIQKGKAPFARKKDQVGGRERFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imwt2: MELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107127 Copy
Species: Other
Genetic Insert: miniTurbo (BirA mutant)
Vector Backbone Description: Vector Backbone:pET21a; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107178 Copy
Species: Other
Genetic Insert: TurboID (BirA mutant)
Vector Backbone Description: Vector Backbone:pET21a; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107177 Copy
Species: Other
Genetic Insert: miniTurbo (BirA mutant)
Vector Backbone Description: Vector Backbone:pLX304; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30125270
Comments: Please visit https://www.biorxiv.org/content/early/2017/10/02/196980 for BioRxiv preprint
Proper citation: RRID:Addgene_107176 Copy
Species: Other
Genetic Insert: hSyn-mCherry-P2A-Cre-WPRE
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29335603
Proper citation: RRID:Addgene_107312 Copy
Species: Other
Genetic Insert: eGFP
Vector Backbone Description: Backbone Size:711; Vector Backbone:pMB1-spect-PthrC3; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:29948110
Proper citation: RRID:Addgene_107409 Copy
Species: Other
Genetic Insert: eGFP
Vector Backbone Description: Backbone Size:711; Vector Backbone:pMB1-spect-PthrC; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:29948110
Proper citation: RRID:Addgene_107408 Copy
Species: Other
Genetic Insert: Luciferase
Vector Backbone Description: Vector Backbone:AAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29224783
Proper citation: RRID:Addgene_107552 Copy
Species: Other
Genetic Insert: Rsc203337 genomic downstream region
Vector Backbone Description: Backbone Marker:Parniske lab; Backbone Size:4190; Vector Backbone:LI+BpiI; Vector Types:Cloning vector; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29077245
Proper citation: RRID:Addgene_104527 Copy
Species: Other
Genetic Insert: Tetracycline resistance gene
Vector Backbone Description: Backbone Marker:Parniske lab; Backbone Size:2458; Vector Backbone:pUC57; Vector Types:Cloning vector; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29077245
Proper citation: RRID:Addgene_104524 Copy
Species: Other
Genetic Insert: eps promoter
Vector Backbone Description: Backbone Marker:Parniske lab; Backbone Size:2458; Vector Backbone:pUC57; Vector Types:Cloning vector; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29077245
Proper citation: RRID:Addgene_104515 Copy
Species: Other
Genetic Insert: UidA gene
Vector Backbone Description: Backbone Marker:Parniske lab; Backbone Size:2458; Vector Backbone:pUC57; Vector Types:Cloning vector; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29077245
Proper citation: RRID:Addgene_104517 Copy
Species: Other
Genetic Insert: AvrPtoB WT
Vector Backbone Description: Backbone Marker:self-made; Backbone Size:2251; Vector Backbone:pICH41308; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:29194629
Comments: release insert with BsaI and clone to Level 1 cloning vector
Proper citation: RRID:Addgene_104710 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.