Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: F-tractin (aa 9-52 of rat ITPKA) fused to mCitrine C-term tagged with the CaaX sequence derived from Kras4b
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32527825
Proper citation: RRID:Addgene_155220 Copy
Species: Dengue virus 4
Genetic Insert: Co expression of DENV4 NS3 full length protein with 47 peptides from NS2B cofactor
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4779; Vector Backbone:pNIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32763315
Proper citation: RRID:Addgene_155320 Copy
Species: Synthetic
Genetic Insert: humanized EBpaRS/BstYam
Vector Backbone Description: Backbone Marker:Clontech, major modifications; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32929862
Comments: The plasmid has been developed for efficient incorporation of Bpa in mammalian cells, first reported in Böttke et al, EMBO reports, 2020. With respect to similar plasmids from other labs, this plasmid contains a humanized gene for EBpaRS and 4 copies of the U6-BstYam tRNA cassette downstream of the synthetase cassette.
Proper citation: RRID:Addgene_155342 Copy
Species: Homo sapiens
Genetic Insert: human wild type KRAS4A-WT
Vector Backbone Description: Backbone Size:2545; Vector Backbone:pDONR221; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32552404
Proper citation: RRID:Addgene_156405 Copy
Species: Homo sapiens
Genetic Insert: human mutant KRAS4A-G12D
Vector Backbone Description: Backbone Size:2545; Vector Backbone:pDONR221; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32552404
Proper citation: RRID:Addgene_156404 Copy
Species: Synthetic
Genetic Insert: mCerulean
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156376 Copy
Species: Synthetic
Genetic Insert: Venus
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156379 Copy
Species: Synthetic
Genetic Insert: ermCL-sfGFP
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156373 Copy
Species: Synthetic
Genetic Insert: Sirius
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156374 Copy
Species: Synthetic
Genetic Insert: mMaroon1
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156388 Copy
Species: Synthetic
Genetic Insert: E2-Crimson
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156387 Copy
Species: Synthetic
Genetic Insert: mCarmine
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156384 Copy
Species: Synthetic
Genetic Insert: Katushka-9-5
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156383 Copy
Species: Synthetic
Genetic Insert: MiCy
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156386 Copy
Species: Synthetic
Genetic Insert: mScarlet-I
Vector Backbone Description: Vector Backbone:pACYC184; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33500394
Proper citation: RRID:Addgene_156381 Copy
Species: Synthetic
Genetic Insert: Nsp10
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAVx
Proper citation: RRID:Addgene_156479 Copy
Species: Synthetic
Genetic Insert: Nsp7
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQx
Proper citation: RRID:Addgene_156476 Copy
Species: Synthetic
Genetic Insert: Nsp9
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQx
Proper citation: RRID:Addgene_156478 Copy
Species: Synthetic
Genetic Insert: Nsp8
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQx
Proper citation: RRID:Addgene_156477 Copy
Species: Synthetic
Genetic Insert: Nsp3c_SUD-C
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: MDSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLR
Proper citation: RRID:Addgene_156471 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
