Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Vector Backbone Description: Backbone Marker:Malcolm Moore lab; Vector Backbone:pUltra-Chili; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088832
Comments: See Addgene plasmid #24129 for cloning details.
Proper citation: RRID:Addgene_48688 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Proper citation: RRID:Addgene_48721 Copy
Vector Backbone Description: Backbone Marker:Malcolm Moore lab; Backbone Size:8300; Vector Backbone:pUltra; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: See Addgene plasmid #24129 for cloning details.
Proper citation: RRID:Addgene_48687 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Lacritin protein sequence in this plasmid is: SILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
Proper citation: RRID:Addgene_48720 Copy
Species: Synthetic
Genetic Insert: AmCyan
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:4000; Vector Backbone:pmR-mCherry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: the nAmCyan and the mCherry genes are separated by a P2A sequence that results in 2 separate proteins. It also includes BsmBI restriction sites flanking the nAmCyan gene which result in BsiWI and BssHII overhangs for cloning in-frame with P2A-mCherry.
Proper citation: RRID:Addgene_48686 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Proper citation: RRID:Addgene_48725 Copy
Species: Homo sapiens
Genetic Insert: Rab8a
Vector Backbone Description: Backbone Size:4100; Vector Backbone:pCS2+HA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25313408
Proper citation: RRID:Addgene_101050 Copy
Species: Homo sapiens
Genetic Insert: KDM4A
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26526725
Proper citation: RRID:Addgene_101052 Copy
Species: Homo sapiens
Genetic Insert: KMT2B homology arms
Vector Backbone Description: Backbone Marker:Eric Mendenhall & Richard M. Myers (Addgene plasmid # 63934); Vector Backbone:pFETCh_Donor; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26355004
Comments: Note: This plasmid is part of the Mendenhall and Meyers CRISPR-based Tagging system to add a tag (currently using FLAG) to endogenous proteins. Please see https://www.addgene.org/crispr/tagging/ for more details.
Proper citation: RRID:Addgene_101070 Copy
Genetic Insert: BDKRB2-dCas9(N)
Vector Backbone Description: Vector Backbone:pTMt_NES_TCS(Q’G)_HA-dCas9( N)_P2A-Puro-WPRE; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28903044
Proper citation: RRID:Addgene_101108 Copy
Species: Rhodopseudomonas palustris CGA009
Genetic Insert: ppsR2
Vector Backbone Description: Vector Backbone:pProTet.E333; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29091422
Proper citation: RRID:Addgene_101068 Copy
Genetic Insert: TMt-dCas9(N)
Vector Backbone Description: Vector Backbone:pX855; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28903044
Proper citation: RRID:Addgene_101101 Copy
Species: Homo sapiens
Genetic Insert: RERE homology arms
Vector Backbone Description: Backbone Marker:Eric Mendenhall & Richard M. Myers (Addgene plasmid # 63934); Vector Backbone:pFETCh_Donor; Vector Types:CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26355004
Comments: Note: This plasmid is part of the Mendenhall and Meyers CRISPR-based Tagging system to add a tag (currently using FLAG) to endogenous proteins. Please see https://www.addgene.org/crispr/tagging/ for more details.
Proper citation: RRID:Addgene_101069 Copy
Genetic Insert: VEGFR2-dCas9(N)
Vector Backbone Description: Vector Backbone:pTMt_NES_TCS(Q’G)_HA-dCas9(N)_P2A-Puro-WPRE; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28903044
Proper citation: RRID:Addgene_101104 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: RP51A
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28829039
Proper citation: RRID:Addgene_100988 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: RP51A
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28829039
Proper citation: RRID:Addgene_100989 Copy
Species: Homo sapiens
Genetic Insert: CMV
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pGL4.18; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21653923
Proper citation: RRID:Addgene_100984 Copy
Vector Backbone Description: Backbone Marker:Feng Zhang lab; Backbone Size:8506; Vector Backbone:eSpCas9(1.1); Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_101039 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: RP51A
Vector Backbone Description: Vector Backbone:pUC18; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28829039
Proper citation: RRID:Addgene_100986 Copy
Species: Homo sapiens
Genetic Insert: NR0B1
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pGL4.18; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21653923
Proper citation: RRID:Addgene_100983 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.