Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 296 showing 5901 ~ 5920 out of 30,517 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_84408

http://www.addgene.org/84408

Species: Synthetic
Genetic Insert: BC14
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84408 Copy   


http://www.addgene.org/84391

Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3034; Vector Backbone:pMuLE ENTR MCS L1-R5; Vector Types:Mammalian Expression, Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30061623
Comments: This truncated CMV promoter is not silenced in neurons.

Proper citation: RRID:Addgene_84391 Copy   


http://www.addgene.org/84392

Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3028; Vector Backbone:pMuLE ENTR MCS L1-R5; Vector Types:Mammalian Expression, Gateway Cloning; Bacterial Resistance:Kanamycin
Comments: This truncated CMV promoter is not silenced in neurons.

Proper citation: RRID:Addgene_84392 Copy   


  • RRID:Addgene_84395

http://www.addgene.org/84395

Species: Synthetic
Genetic Insert: BC1
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84395 Copy   


  • RRID:Addgene_84425

http://www.addgene.org/84425

Species: Synthetic
Genetic Insert: BC31
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84425 Copy   


  • RRID:Addgene_84424

http://www.addgene.org/84424

Species: Synthetic
Genetic Insert: BC30
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84424 Copy   


  • RRID:Addgene_84384

    This resource has 1+ mentions.

http://www.addgene.org/84384

Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3834; Vector Backbone:pMuLE Dest BlastR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30263951

Proper citation: RRID:Addgene_84384 Copy   


  • RRID:Addgene_84383

    This resource has 10+ mentions.

http://www.addgene.org/84383

Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3834; Vector Backbone:pMuLE Dest BlastR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30061623

Proper citation: RRID:Addgene_84383 Copy   


http://www.addgene.org/84388

Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3076; Vector Backbone:pMuLE ENTR MCS L1-R5; Vector Types:Mammalian Expression, Gateway Cloning; Bacterial Resistance:Kanamycin
Comments: This truncated CMV promoter is not silenced in neurons.

Proper citation: RRID:Addgene_84388 Copy   


  • RRID:Addgene_84441

http://www.addgene.org/84441

Species: Synthetic
Genetic Insert: BC47
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84441 Copy   


  • RRID:Addgene_84440

http://www.addgene.org/84440

Species: Synthetic
Genetic Insert: BC46
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84440 Copy   


  • RRID:Addgene_84442

http://www.addgene.org/84442

Species: Synthetic
Genetic Insert: BC48
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84442 Copy   


  • RRID:Addgene_84538

    This resource has 1+ mentions.

http://www.addgene.org/84538

Species: Synthetic
Genetic Insert: FLIP - Puro
Vector Backbone Description: Backbone Marker:TAKARA; Vector Backbone:pUC118; Vector Types:Mouse Targeting, Cre/Lox; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28135257

Proper citation: RRID:Addgene_84538 Copy   


  • RRID:Addgene_84434

http://www.addgene.org/84434

Species: Synthetic
Genetic Insert: BC40
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84434 Copy   


  • RRID:Addgene_84435

http://www.addgene.org/84435

Species: Synthetic
Genetic Insert: BC41
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84435 Copy   


  • RRID:Addgene_84437

http://www.addgene.org/84437

Species: Synthetic
Genetic Insert: BC43
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84437 Copy   


  • RRID:Addgene_84439

http://www.addgene.org/84439

Species: Synthetic
Genetic Insert: BC45
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84439 Copy   


  • RRID:Addgene_84430

http://www.addgene.org/84430

Species: Synthetic
Genetic Insert: BC36
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84430 Copy   


  • RRID:Addgene_84427

http://www.addgene.org/84427

Species: Synthetic
Genetic Insert: BC33
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/

Proper citation: RRID:Addgene_84427 Copy   


http://www.addgene.org/84603

Species: Synthetic
Genetic Insert: mCherry
Vector Backbone Description: Backbone Marker:K. Kawakami lab; Vector Backbone:pT2KXIG; Vector Types:Zebrafish transgenesis; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25068273
Comments: The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.

Proper citation: RRID:Addgene_84603 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X