Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: BC14
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84408 Copy
Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3034; Vector Backbone:pMuLE ENTR MCS L1-R5; Vector Types:Mammalian Expression, Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30061623
Comments: This truncated CMV promoter is not silenced in neurons.
Proper citation: RRID:Addgene_84391 Copy
Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3028; Vector Backbone:pMuLE ENTR MCS L1-R5; Vector Types:Mammalian Expression, Gateway Cloning; Bacterial Resistance:Kanamycin
Comments: This truncated CMV promoter is not silenced in neurons.
Proper citation: RRID:Addgene_84392 Copy
Species: Synthetic
Genetic Insert: BC1
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84395 Copy
Species: Synthetic
Genetic Insert: BC31
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84425 Copy
Species: Synthetic
Genetic Insert: BC30
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84424 Copy
Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3834; Vector Backbone:pMuLE Dest BlastR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30263951
Proper citation: RRID:Addgene_84384 Copy
Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3834; Vector Backbone:pMuLE Dest BlastR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30061623
Proper citation: RRID:Addgene_84383 Copy
Species: Synthetic
Genetic Insert: Lifeact
Vector Backbone Description: Backbone Size:3076; Vector Backbone:pMuLE ENTR MCS L1-R5; Vector Types:Mammalian Expression, Gateway Cloning; Bacterial Resistance:Kanamycin
Comments: This truncated CMV promoter is not silenced in neurons.
Proper citation: RRID:Addgene_84388 Copy
Species: Synthetic
Genetic Insert: BC47
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84441 Copy
Species: Synthetic
Genetic Insert: BC46
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84440 Copy
Species: Synthetic
Genetic Insert: BC48
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84442 Copy
Species: Synthetic
Genetic Insert: FLIP - Puro
Vector Backbone Description: Backbone Marker:TAKARA; Vector Backbone:pUC118; Vector Types:Mouse Targeting, Cre/Lox; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28135257
Proper citation: RRID:Addgene_84538 Copy
Species: Synthetic
Genetic Insert: BC40
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84434 Copy
Species: Synthetic
Genetic Insert: BC41
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84435 Copy
Species: Synthetic
Genetic Insert: BC43
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84437 Copy
Species: Synthetic
Genetic Insert: BC45
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84439 Copy
Species: Synthetic
Genetic Insert: BC36
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84430 Copy
Species: Synthetic
Genetic Insert: BC33
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84427 Copy
Species: Synthetic
Genetic Insert: mCherry
Vector Backbone Description: Backbone Marker:K. Kawakami lab; Vector Backbone:pT2KXIG; Vector Types:Zebrafish transgenesis; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25068273
Comments: The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.
Proper citation: RRID:Addgene_84603 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
