Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pUltra-Chili-Luc Resource Report Resource Website 10+ mentions |
RRID:Addgene_48688 | Ampicillin | PMID:34088832 | See Addgene plasmid #24129 for cloning details. | Backbone Marker:Malcolm Moore lab; Vector Backbone:pUltra-Chili; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 33 | |||
|
pTYB1-pLAC-V69S Resource Report Resource Website |
RRID:Addgene_48721 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Valine 69 to Serine | 2026-08-15 01:15:53 | 0 |
|
pUltra-Chili Resource Report Resource Website 10+ mentions |
RRID:Addgene_48687 | Ampicillin | See Addgene plasmid #24129 for cloning details. | Backbone Marker:Malcolm Moore lab; Backbone Size:8300; Vector Backbone:pUltra; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:15:53 | 19 | ||||
|
pTYB1-pLAC-N71 Resource Report Resource Website |
RRID:Addgene_48720 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: SILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Deleted first 71 amino acids of mature lacritin without signal peptide | 2026-08-15 01:15:53 | 0 |
|
AmCyan-P2A-Xerry Resource Report Resource Website |
RRID:Addgene_48686 | AmCyan | Synthetic | Kanamycin | the nAmCyan and the mCherry genes are separated by a P2A sequence that results in 2 separate proteins. It also includes BsmBI restriction sites flanking the nAmCyan gene which result in BsiWI and BssHII overhangs for cloning in-frame with P2A-mCherry. | Backbone Marker:clontech; Backbone Size:4000; Vector Backbone:pmR-mCherry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | SV40 NLS | 2026-08-15 01:15:53 | 0 | |
|
pTYB-pLAC-L108S Resource Report Resource Website |
RRID:Addgene_48725 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Leucine 108 to Serine | 2026-08-15 01:15:53 | 0 |
|
HA-Rab8a-CA (Q67L) Resource Report Resource Website 1+ mentions |
RRID:Addgene_101050 | Rab8a | Homo sapiens | Ampicillin | PMID:25313408 | Backbone Size:4100; Vector Backbone:pCS2+HA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Q67L | 2026-08-15 01:00:16 | 1 | |
|
pcDNA-flag-hKDM4A(H188A)-polyA Resource Report Resource Website 1+ mentions |
RRID:Addgene_101052 | KDM4A | Homo sapiens | Ampicillin | PMID:26526725 | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:16 | 1 | ||
|
pFETCh_KMT2B Resource Report Resource Website |
RRID:Addgene_101070 | KMT2B homology arms | Homo sapiens | Kanamycin | PMID:26355004 | Note: This plasmid is part of the Mendenhall and Meyers CRISPR-based Tagging system to add a tag (currently using FLAG) to endogenous proteins. Please see https://www.addgene.org/crispr/tagging/ for more details. | Backbone Marker:Eric Mendenhall & Richard M. Myers (Addgene plasmid # 63934); Vector Backbone:pFETCh_Donor; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-08-15 01:00:17 | 0 | |
|
pBDKRB2_TCS(Q’L)_HA-dCas9(N)_P2A-Puro-WPRE Resource Report Resource Website |
RRID:Addgene_101108 | BDKRB2-dCas9(N) | Ampicillin | PMID:28903044 | Vector Backbone:pTMt_NES_TCS(Q’G)_HA-dCas9( N)_P2A-Puro-WPRE; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:17 | 0 | |||
|
pNO183 Resource Report Resource Website |
RRID:Addgene_101068 | ppsR2 | Rhodopseudomonas palustris CGA009 | Chloramphenicol | PMID:29091422 | Vector Backbone:pProTet.E333; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2026-08-15 01:00:17 | 0 | ||
|
pTMt_NES_TCS(Q’G)_HA-dCas9(N)_P2A-Puro-WPRE Resource Report Resource Website |
RRID:Addgene_101101 | TMt-dCas9(N) | Ampicillin | PMID:28903044 | Vector Backbone:pX855; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:17 | 0 | |||
|
pFETCh_RERE Resource Report Resource Website |
RRID:Addgene_101069 | RERE homology arms | Homo sapiens | Kanamycin | PMID:26355004 | Note: This plasmid is part of the Mendenhall and Meyers CRISPR-based Tagging system to add a tag (currently using FLAG) to endogenous proteins. Please see https://www.addgene.org/crispr/tagging/ for more details. | Backbone Marker:Eric Mendenhall & Richard M. Myers (Addgene plasmid # 63934); Vector Backbone:pFETCh_Donor; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-08-15 01:00:17 | 0 | |
|
pVEGFR2_TEV(N)_NES_TCS(Q'L)_HA-dCas9(N)_P2A_Puro-WPRE Resource Report Resource Website |
RRID:Addgene_101104 | VEGFR2-dCas9(N) | Ampicillin | PMID:28903044 | Vector Backbone:pTMt_NES_TCS(Q’G)_HA-dCas9(N)_P2A-Puro-WPRE; Vector Types:Mammalian Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:17 | 0 | |||
|
Rp51a Hyperstabilized 5'SS Resource Report Resource Website |
RRID:Addgene_100988 | RP51A | Saccharomyces cerevisiae | Ampicillin | PMID:28829039 | Vector Backbone:pUC18; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin | 5'ss mut ATG/GTATGT -> AAG/GTAAGT | 2026-08-15 01:00:16 | 0 | |
|
Rp51a_10bp 5'SS_No BP or pBP_pUC18 Resource Report Resource Website |
RRID:Addgene_100989 | RP51A | Saccharomyces cerevisiae | Ampicillin | PMID:28829039 | Vector Backbone:pUC18; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin | tGGTAtGTta->AGGTAAGTAT 5'SS mutant, TACTAAC->GTTAGTG BP mutataion and a TACAAAC->GTTTGTG pseudo BP mutation | 2026-08-15 01:00:16 | 0 | |
|
pGL4.18 CMV-Luc Resource Report Resource Website 1+ mentions |
RRID:Addgene_100984 | CMV | Homo sapiens | Ampicillin | PMID:21653923 | Backbone Marker:Promega; Vector Backbone:pGL4.18; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:16 | 3 | ||
|
eSpCas9(1.1)-T2A-Puro Resource Report Resource Website 1+ mentions |
RRID:Addgene_101039 | Ampicillin | Backbone Marker:Feng Zhang lab; Backbone Size:8506; Vector Backbone:eSpCas9(1.1); Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:16 | 7 | |||||
|
RP51A-NoBS-NoPseudoBS Resource Report Resource Website |
RRID:Addgene_100986 | RP51A | Saccharomyces cerevisiae | Ampicillin | PMID:28829039 | Vector Backbone:pUC18; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin | BS mutated to GTTAGTG, pseudo BS mutated to GTTTGTG | 2026-08-15 01:00:16 | 0 | |
|
pGL4.18 NR0B1-Luc Resource Report Resource Website |
RRID:Addgene_100983 | NR0B1 | Homo sapiens | Ampicillin | PMID:21653923 | Backbone Marker:Promega; Vector Backbone:pGL4.18; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:00:16 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
