Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:rattus norvegicus (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

2,175 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pFSynW Syt1 WT IRES mRuby3
 
Resource Report
Resource Website 		RRID:Addgene_170639 SYT1 Rattus norvegicus Ampicillin PMID:32362337 Vector Backbone:FUGW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:22:52 0
pBabe NGF-Erbb2-2xFKBP-HA hygro
 
Resource Report
Resource Website 		RRID:Addgene_192291 NGF-Erbb2-2xFKBP-HA Rattus norvegicus Ampicillin PMID:37055441 Backbone Marker:Addgene #1765; Vector Backbone:pBabe hygro; Vector Types:Retroviral; Bacterial Resistance:Ampicillin 2026-08-15 01:26:19 0
NGL-1-myc/pEGFP-N1
 
Resource Report
Resource Website 		RRID:Addgene_197314 Neuroligin-1 Rattus norvegicus Ampicillin This is a validated antigen plasmid of Anti-Neuroligin-1 [N97A/31R]. Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:18 0
pGL3-MTS-COX2-Q6-L18-G1333N-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198844 COX2-Q6-L18 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:20 0
pGL3-MTS-COX1-W25-L15-G1333C-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198842 COX1-W25-L15 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:18 0
pGL3-MTS-ATP8-W9-L17-G1333C-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198840 ATP8-W9-L17 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:18 0
pGL3-MTS-ND4-W24-L18-G1333C-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198856 ND4-W24-L18 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:20 0
pGL3-MTS-ATP6-W68-L16-G1333C-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198838 ATP6-W68-L16 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:20 0
pEGFPC2-gephyrin C3
 
Resource Report
Resource Website 		RRID:Addgene_199610 Gephyrin Rattus norvegicus Kanamycin PMID:36314779 Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons) Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin C3 cassette insertion 2026-08-15 01:26:23 0
pGL3-MTS-CYTB-W77-R14-G1333N-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198849 CYTB-W77-R14 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:22 0
pGL3-MTS-COX2-Q6-R18-G1333C-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198845 COX2-Q6-R18 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:24 0
pGL3-MTS-ATP8-W9-R15-G1333N-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198841 ATP8-W9-R15 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:22 0
pGL3-MTS-ND4-W24-R17-G1333N-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198857 ND4-W24-R17 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:22 0
pGL3-MTS-ATP6-W68-R17-G1333N-UGI-Puro
 
Resource Report
Resource Website 		RRID:Addgene_198839 ATP6-W68-R17 TALEN Rattus norvegicus Ampicillin PMID:37058569 These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:24 0
pCI pHluorin Syt12
 
Resource Report
Resource Website 		RRID:Addgene_184513 Synaptotagmin 12 Rattus norvegicus Ampicillin PMID:22398727 The first codon of the Synpatotagmin has been removed Backbone Marker:Promega; Backbone Size:4006; Vector Backbone:pCI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:27 0
pBactin-Nedd1-mNeonGreen
 
Resource Report
Resource Website 		RRID:Addgene_196864 Nedd1-mNeonGreen Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:6789; Vector Backbone:pBeta-actin-Tubg1-mNeonGreen ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:30 0
pCAG-Halo-Tag-128-425-Akap9
 
Resource Report
Resource Website 		RRID:Addgene_196873 Halo-Tag-Akap9 (128-425) Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:4998; Vector Backbone:pCAG-lox; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:26:28 0
pBactin-AcGFP-Cdk5rap2-CTDdeltaCBD
 
Resource Report
Resource Website 		RRID:Addgene_196856 AcGFP-Cdk5rap2-CTDdeltaCBD Rattus norvegicus Ampicillin PMID:36796357 Lacking the centrosome-binding domain (CBD): VITHQVLRKA Backbone Size:6748; Vector Backbone:pBeta-actin-AcGFP-CI ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Lacking the centrosome-targeting domain (CTD) 2026-08-15 01:26:30 0
pCAG-lox-inv[Talpha1-iCre-pA]-lox-2xHA-128-425-Akap9
 
Resource Report
Resource Website 		RRID:Addgene_196897 2xHA-Akap9(128-425) Rattus norvegicus Ampicillin PMID:36796357 Backbone Size:7546; Vector Backbone:pCAG-lox; Vector Types:Mammalian Expression, Cre/Lox; Bacterial Resistance:Ampicillin 2026-08-15 01:26:31 0
FAS promoter luciferase
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_8890 Fatty Acid Synthetase Promoter Rattus norvegicus Ampicillin PMID:9421459 -220 to +25 fragment of the Fatty Acid Synthetase promoter with regard to the transcription start site. Vector Backbone:n/a; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-08-15 01:21:53 5

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch