Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: Src wildtype
Vector Backbone Description: Backbone Marker:modified from ThermoFisher 12274015; Backbone Size:7100; Vector Backbone:modified pcDNA-pDEST40; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30304684
Proper citation: RRID:Addgene_140295 Copy
Species: Homo sapiens
Genetic Insert: SSAT1
Vector Backbone Description: Vector Backbone:pOP-SVI-MCS; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15905201
Proper citation: RRID:Addgene_140291 Copy
Species: Homo sapiens
Genetic Insert: DNA damage response
Vector Backbone Description: Backbone Marker:Addgene; Vector Backbone:lentiCRISPRv2; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31991288
Proper citation: RRID:Addgene_140219 Copy
Species: Homo sapiens
Genetic Insert: HPV 16 E7 Q mutant
Vector Backbone Description: Backbone Size:6550; Vector Backbone:pCMV bam neo; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_13696 Copy
Species: Homo sapiens
Genetic Insert: HPV 16 E7 L67K
Vector Backbone Description: Backbone Size:6550; Vector Backbone:pCMV bam neo; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_13694 Copy
Species: Homo sapiens
Genetic Insert: NIMA-like kinase 10
Vector Backbone Description: Backbone Size:8454; Vector Backbone:pLRC1; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31959991
Proper citation: RRID:Addgene_137030 Copy
Species: Homo sapiens
Genetic Insert: mCherry
Vector Backbone Description: Backbone Size:3168; Vector Backbone:pUC19; Vector Types:Bacterial Expression, PCR template for donor DNA; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31710422
Proper citation: RRID:Addgene_137086 Copy
Species: Homo sapiens
Genetic Insert: tagRFP
Vector Backbone Description: Backbone Size:3168; Vector Backbone:pUC19; Vector Types:Bacterial Expression, PCR template for donor DNA; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31710422
Proper citation: RRID:Addgene_137088 Copy
Species: Homo sapiens
Genetic Insert: NKAP
Vector Backbone Description: Backbone Size:5740; Vector Backbone:pET15-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: insert+fusion tag if applicable MHHHHHHSSGRENLYFQGMAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLSERERIGEL sequence of insert only (no fusion tag) MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLSERERIGEL
Proper citation: RRID:Addgene_137206 Copy
Species: Homo sapiens
Genetic Insert: SIRT1
Vector Backbone Description: Backbone Marker:Qiagen; Backbone Size:4700; Vector Backbone:pQE-80; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16790548
Comments: Truncated form of SIRT1. Missing amino acids 6-83. Molecular Weight: 81681 Da.
Proper citation: RRID:Addgene_13735 Copy
Species: Homo sapiens
Genetic Insert: SIRT5
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-KG; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16790548
Comments: Full length SIRT5.
Proper citation: RRID:Addgene_13738 Copy
Species: Homo sapiens
Genetic Insert: SIRT4
Vector Backbone Description: Backbone Marker:Qiagen; Backbone Size:4700; Vector Backbone:pQE-80; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16790548
Comments: Full length SIRT4. Molecular Weight: 35188 Da.
Proper citation: RRID:Addgene_13737 Copy
Species: Homo sapiens
Genetic Insert: SIRT7
Vector Backbone Description: Backbone Marker:Qiagen; Backbone Size:4700; Vector Backbone:pQE-80; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16790548
Comments: Derived from pcDNA3.1 SIRT1–7 with a FLAG tag, obtained from E. Verdin (University of California, San Francisco). Molecular Weight: 44898 Da.
Proper citation: RRID:Addgene_13740 Copy
Species: Homo sapiens
Genetic Insert: HPV 16 E6 E7
Vector Backbone Description: Backbone Size:7500; Vector Backbone:pB-actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:2476573
Proper citation: RRID:Addgene_13718 Copy
Species: Homo sapiens
Genetic Insert: HPV 16 E6 E7
Vector Backbone Description: Backbone Size:7500; Vector Backbone:pB-actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:2476573
Proper citation: RRID:Addgene_13717 Copy
Species: Homo sapiens
Genetic Insert: CALCOCO1 R12H
Vector Backbone Description: Vector Backbone:pCMV6-Entry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31971854
Proper citation: RRID:Addgene_137770 Copy
Species: Homo sapiens
Genetic Insert: BRD4 long isoform
Vector Backbone Description: Backbone Size:8400; Vector Backbone:pCW57-GFP-2A-MCS; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32966794
Proper citation: RRID:Addgene_137720 Copy
Species: Homo sapiens
Genetic Insert: BRD4 long isoform without its C-terminal, P-TEFb interacting domain
Vector Backbone Description: Backbone Size:8400; Vector Backbone:pCW57-GFP-2A-MCS; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32966794
Proper citation: RRID:Addgene_137722 Copy
Species: Homo sapiens
Genetic Insert: U1A (1-94)
Vector Backbone Description: Backbone Size:4967; Vector Backbone:pRS313; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11142374
Comments: CEN plasmid, GAL1 promoter
Proper citation: RRID:Addgene_1376 Copy
Species: Homo sapiens
Genetic Insert: MAP1LC3C
Vector Backbone Description: Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31971854
Proper citation: RRID:Addgene_137758 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
