Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:homo sapiens (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

69,655 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pDEST40-2XFL-wtSrc
 
Resource Report
Resource Website 		RRID:Addgene_140295 Src wildtype Homo sapiens Ampicillin PMID:30304684 Backbone Marker:modified from ThermoFisher 12274015; Backbone Size:7100; Vector Backbone:modified pcDNA-pDEST40; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:40 0
pOP/SSAT
 
Resource Report
Resource Website 		RRID:Addgene_140291 SSAT1 Homo sapiens Ampicillin PMID:15905201 Vector Backbone:pOP-SVI-MCS; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:40 0
DDR_MKOv4
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_140219 DNA damage response Homo sapiens Ampicillin PMID:31991288 Backbone Marker:Addgene; Vector Backbone:lentiCRISPRv2; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:06:40 2
cmv 16 E7 Q mutant
 
Resource Report
Resource Website 		RRID:Addgene_13696 HPV 16 E7 Q mutant Homo sapiens Ampicillin Backbone Size:6550; Vector Backbone:pCMV bam neo; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin aa 30-37 changed from DSSEEEDE to QSSQQQQQ. 2026-08-15 01:06:12 0
cmv 16 E7 L67K
 
Resource Report
Resource Website 		RRID:Addgene_13694 HPV 16 E7 L67K Homo sapiens Ampicillin Backbone Size:6550; Vector Backbone:pCMV bam neo; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin aa 67 from L to K 2026-08-15 01:06:11 0
pLRC1-NEK10p:NEK10-3XFLAG
 
Resource Report
Resource Website 		RRID:Addgene_137030 NIMA-like kinase 10 Homo sapiens Ampicillin PMID:31959991 Backbone Size:8454; Vector Backbone:pLRC1; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:06:12 0
pAP1837
 
Resource Report
Resource Website 		RRID:Addgene_137086 mCherry Homo sapiens Ampicillin PMID:31710422 Backbone Size:3168; Vector Backbone:pUC19; Vector Types:Bacterial Expression, PCR template for donor DNA; Bacterial Resistance:Ampicillin 2026-08-15 01:06:13 0
pAP1680
 
Resource Report
Resource Website 		RRID:Addgene_137088 tagRFP Homo sapiens Ampicillin PMID:31710422 Backbone Size:3168; Vector Backbone:pUC19; Vector Types:Bacterial Expression, PCR template for donor DNA; Bacterial Resistance:Ampicillin 2026-08-15 01:06:13 0
NKAP.001.140
 
Resource Report
Resource Website 		RRID:Addgene_137206 NKAP Homo sapiens Ampicillin insert+fusion tag if applicable MHHHHHHSSGRENLYFQGMAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLSERERIGEL sequence of insert only (no fusion tag) MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLSERERIGEL Backbone Size:5740; Vector Backbone:pET15-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 001-140 2026-08-15 01:06:14 0
SIRT1.1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_13735 SIRT1 Homo sapiens Ampicillin PMID:16790548 Truncated form of SIRT1. Missing amino acids 6-83. Molecular Weight: 81681 Da. Backbone Marker:Qiagen; Backbone Size:4700; Vector Backbone:pQE-80; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:14 4
SIRT5.1
 
Resource Report
Resource Website 		RRID:Addgene_13738 SIRT5 Homo sapiens Ampicillin PMID:16790548 Full length SIRT5. Backbone Size:5000; Vector Backbone:pGEX-KG; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:14 0
SIRT4.23
 
Resource Report
Resource Website 		RRID:Addgene_13737 SIRT4 Homo sapiens Ampicillin PMID:16790548 Full length SIRT4. Molecular Weight: 35188 Da. Backbone Marker:Qiagen; Backbone Size:4700; Vector Backbone:pQE-80; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:15 0
SIRT7.4
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_13740 SIRT7 Homo sapiens Ampicillin PMID:16790548 Derived from pcDNA3.1 SIRT1–7 with a FLAG tag, obtained from E. Verdin (University of California, San Francisco). Molecular Weight: 44898 Da. Backbone Marker:Qiagen; Backbone Size:4700; Vector Backbone:pQE-80; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:15 1
pB-actin E6, E7 TTL
 
Resource Report
Resource Website 		RRID:Addgene_13718 HPV 16 E6 E7 Homo sapiens Ampicillin PMID:2476573 Backbone Size:7500; Vector Backbone:pB-actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Translation termination linker at bp 711 of E7 so no expression. 2026-08-15 01:06:14 0
pB-actin E6 TTL2, E7
 
Resource Report
Resource Website 		RRID:Addgene_13717 HPV 16 E6 E7 Homo sapiens Ampicillin PMID:2476573 Backbone Size:7500; Vector Backbone:pB-actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Translation termination linker at bp 280 of E6 so no expression. 2026-08-15 01:06:14 0
CALCOCO1 R12H-mycDDK
 
Resource Report
Resource Website 		RRID:Addgene_137770 CALCOCO1 R12H Homo sapiens Kanamycin PMID:31971854 Vector Backbone:pCMV6-Entry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin R12H 2026-08-15 01:06:16 0
pCW57-mCherry-2A-BRD4 Iso A
 
Resource Report
Resource Website 		RRID:Addgene_137720 BRD4 long isoform Homo sapiens Ampicillin PMID:32966794 Backbone Size:8400; Vector Backbone:pCW57-GFP-2A-MCS; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:06:15 0
pCW57-mCherry-2A-BRD4 Iso AdelCTD
 
Resource Report
Resource Website 		RRID:Addgene_137722 BRD4 long isoform without its C-terminal, P-TEFb interacting domain Homo sapiens Ampicillin PMID:32966794 Backbone Size:8400; Vector Backbone:pCW57-GFP-2A-MCS; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin Truncated at amino acid 1328 2026-08-15 01:06:16 0
pPS2045
 
Resource Report
Resource Website 		RRID:Addgene_1376 U1A (1-94) Homo sapiens Ampicillin PMID:11142374 CEN plasmid, GAL1 promoter Backbone Size:4967; Vector Backbone:pRS313; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin U1A (1-94) 2026-08-15 01:06:15 0
HA-MAP1LC3C
 
Resource Report
Resource Website 		RRID:Addgene_137758 MAP1LC3C Homo sapiens Ampicillin PMID:31971854 Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:06:16 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch