Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pcDNA-FLAG-GPD1L Resource Report Resource Website |
RRID:Addgene_32486 | GPD1L | Mus musculus | Ampicillin | PMID:21555452 | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:32 | 0 | ||
|
pcDNA-FLAG-GPD1 Resource Report Resource Website |
RRID:Addgene_32487 | GPD1 | Mus musculus | Ampicillin | PMID:21555452 | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:32 | 0 | ||
|
EGFP-talin1 rod Resource Report Resource Website 1+ mentions |
RRID:Addgene_32855 | Talin 1 Rod aa 434-2541 | Mus musculus | Kanamycin | PMID:17114441 | Please note that both the full plasmid sequence from the depositing laboratory and Addgene's sequencing results indicate a K673N mutation/SNP when the sequences are compared to GenBank entry NP_035732.2. The depositing laboratory states that this difference is not a concern for the function of the plasmid. The most appropriate reference sequence for the Talin1 insert in the plasmid is GenBank accession number CAA39588.1. | Backbone Marker:BD Clontech; Backbone Size:4749; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-25 09:21:34 | 3 | |
|
pENTR-L5-Kir2.1-mCherry-L2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32669 | Kir2.1-mCherry | Mus musculus | Kanamycin | PMID:21772812 | Backbone Marker:Invitrogen; Vector Backbone:pDONR221 P5-P2; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-25 09:21:33 | 4 | ||
|
pcDNA mouse NHERF-1 (1-355) Resource Report Resource Website 1+ mentions |
RRID:Addgene_32705 | solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1 | Mus musculus | Ampicillin | PMID:11457730 | Backbone Marker:Invitrogen; Backbone Size:5600; Vector Backbone:pcDNA3.1/Hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | none | 2026-08-25 09:21:33 | 1 | |
|
CMV500 A-CREB Resource Report Resource Website 1+ mentions |
RRID:Addgene_33371 | CREB | Mus musculus | Ampicillin | PMID:9447994 | A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see notes) | 2026-08-25 09:21:39 | 5 |
|
CMV500 A-C/EBPβ Resource Report Resource Website 1+ mentions |
RRID:Addgene_33363 | Cebpb | Mus musculus | Ampicillin | This is the dominant negative Cebpb- which contains an N-terminal acidic extension (LEQRAEELARENEELEKEAEELEQENAE) fused to the HLH-ZIP region of Cebpb. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see comments) | 2026-08-25 09:21:39 | 3 | |
|
pcDNA3.1/FGFR2-S252W(Apert) myc Resource Report Resource Website |
RRID:Addgene_33249 | FGFR2 | Mus musculus | Ampicillin | PMID:10851026 | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Mutation S252W in FGFR2 found in Apert syndrome. cDNA is a 3-Ig domain (IIIC) isoform of FGFR2. KpnI site introduced at stop codon to be inframe with myc-his tag from pcDNA vector | 2026-08-25 09:21:38 | 0 | |
|
pcDNA3.1-mNFIL-3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_34572 | NFIL-3 | Mus musculus | Ampicillin | PMID:21566115 | Backbone Marker:Invitrogen; Backbone Size:5597; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 1 | ||
|
CMV500 A-ATF2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_33362 | ATF | Mus musculus | Ampicillin | This is the dominant negative ATF- which contains an N-terminal acidic extension fused to the HLH-ZIP region of ATF. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative (see comments) | 2026-08-25 09:21:39 | 4 | |
|
pGL3-mArg1 promoter/enhancer -31/-3810 Resource Report Resource Website 1+ mentions |
RRID:Addgene_34571 | Arg1 promoter/enhancer -31/-3810 | Mus musculus | Ampicillin | PMID:15187136 | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 5 | ||
|
pGL3-mArg1 base promoter -31/-2365 Resource Report Resource Website |
RRID:Addgene_34570 | Arg1 base promoter -31/-2365 | Mus musculus | Ampicillin | PMID:15187136 | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Luciferase; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 0 | ||
|
CMV500 A-FOS Resource Report Resource Website 10+ mentions |
RRID:Addgene_33353 | FOS | Mus musculus | Ampicillin | PMID:9447994 | Acidic amphipathic extension added to the Fos leucine zipper: LEQRAEELARENEELEKEAEELEQELAE Although the acidic extension is to the c-Fos leucine zipper, A-Fos heterodimerizes and inhibits c-Jun. | Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Dominant Negative of c-Jun; heterodimerizes and inhibits c-Jun | 2026-08-25 09:21:38 | 10 |
|
pSfi-HspLacZ Resource Report Resource Website 1+ mentions |
RRID:Addgene_33351 | Hsp68 promoter | Mus musculus | Ampicillin | PMID:12915490 | For more information about this plasmid see attached information sheet. | Backbone Marker:Stratagene; Backbone Size:2800; Vector Backbone:pBluescript; Vector Types:Mammalian Expression, Mouse Targeting; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:38 | 4 | |
|
mSIRT3-S Resource Report Resource Website |
RRID:Addgene_33310 | Sirt3 | Mus musculus | Ampicillin | PMID:20235147 | This is the short form, lacking the 63 aa N-terminal aa included in the long form. | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:38 | 0 | |
|
pmCherry-C1-FAK-HA-V744G Resource Report Resource Website |
RRID:Addgene_35040 | focal adhesion kinase | Mus musculus | Kanamycin | PMID:20150423 | Please note that both the full plasmid sequence and Addgene's sequencing result identified a Y42H mutation when compared to GenBank entry NP_032008.2. The final two FAK amino acids are missing in this construct, as the original source for the FAK construct used in this plasmid was originally missing these same amino acids. The depositing laboratory states that the deletion should not affect any FAK function since it is outside of the FAK primary sequence. | Backbone Marker:BD Clontech; Backbone Size:4700; Vector Backbone:pmCherry-c1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | GFP-FAK-V744G was generated from GFP-FAK using the QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA) with the following primers: forward, 5′-CAATCACTACCAGGGCTCTGGCTACCCG-3′; and reverse, 5′-CGGGTAGCCAGAGCCCTGGTAGTGATTG-3′; deletion of amino acids 1051 & 1052 | 2026-08-25 09:21:44 | 0 |
|
p3xFLAG-mSlug Resource Report Resource Website 1+ mentions |
RRID:Addgene_34584 | Slug | Mus musculus | Ampicillin | PMID:21610693 | Backbone Marker:Sigma; Backbone Size:4700; Vector Backbone:p3xFlag-CMV-7.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 1 | ||
|
p3xFLAG-mSnail Resource Report Resource Website 1+ mentions |
RRID:Addgene_34583 | Snail | Mus musculus | Ampicillin | PMID:21610693 | Backbone Marker:Sigma; Backbone Size:4700; Vector Backbone:p3xFlag-CMV-7.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 2 | ||
|
pcDNA3.1-mASS1 Resource Report Resource Website |
RRID:Addgene_34576 | ASS1 | Mus musculus | Ampicillin | Backbone Marker:Invitrogen; Backbone Size:5597; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 0 | |||
|
pcDNA3.1-3xHA-mASL Resource Report Resource Website 1+ mentions |
RRID:Addgene_34577 | ASL | Mus musculus | Ampicillin | Backbone Marker:Invitrogen; Backbone Size:5597; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-25 09:21:41 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
