Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
LCMV:ECFP(loxP)(FRT)MCS Resource Report Resource Website 1+ mentions |
RRID:Addgene_31377 | ECFP(loxP)MCS | Ampicillin | PMID:11376165 | Cre and Flp reporter: from blue protein fluorescence to gene of interested inserted into multiple cloning site (MCS) | Backbone Size:4100; Vector Backbone:pCS2+; Vector Types:Mammalian Expression, Cre/Lox, Flp/FRT; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:31 | 1 | ||
|
pCVL Traffic Light Reporter 2.1 (VF2468 ZFN target) Ef1a Resource Report Resource Website 1+ mentions |
RRID:Addgene_31483 | Traffic Light Reporter 2.1 (V2468 zfn target) EF Puro | Ampicillin | PMID:21743461 | Backbone Size:5000; Vector Backbone:pCVL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | Traffic Light 2.0 series have a +3 PEST sequence that aids in degradation of the +3 "gibberishFP" produced by mutNHEJ events. The mCherry sequence has M9S and M16L mutations that reduce background fluorescence from internal start codons. This is what ".1" stands for. | 2026-08-15 01:13:32 | 2 | ||
|
pCVL Traffic Light Reporter 1.1 (Sce target) Ef1a Puro Resource Report Resource Website 10+ mentions |
RRID:Addgene_31482 | Traffic Light Reporter 1.1 (Sce Target) EF Puro | Ampicillin | PMID:21743461 | Backbone Size:5000; Vector Backbone:pCVL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | mCherry has M9S and M16L mutations. This is what the ".1" means. | 2026-08-15 01:13:35 | 27 | ||
|
pFB-GluCl_cryst Resource Report Resource Website 1+ mentions |
RRID:Addgene_31488 | C. elegans glutamate-gated chloride channel alpha, crystallized construct | Caenorhabditis elegans | Ampicillin | PMID:21572436 | Backbone Marker:Invitrogen; Backbone Size:4800; Vector Backbone:pFastbac1; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:36 | 1 | ||
|
pRsetB-pHRed Resource Report Resource Website 1+ mentions |
RRID:Addgene_31472 | pHRed | Synthetic | Ampicillin | PMID:21631110 | Backbone Marker:Invitrogen; Backbone Size:2760; Vector Backbone:pRsetB; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:36 | 2 | ||
|
pQStrep2-PREI3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31592 | preimplantation protein 3 | Homo sapiens | Ampicillin | PMID:15998469 | Please note that there is a small gap between Addgene's quality control sequence and the reference sequence provided by the depositor. The gap is downstream of the ORF and should not affect function. | Backbone Size:3460; Vector Backbone:pQStrep2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | |
|
pCVL SFFV d14GFP EF1s HA.NLS.Sce(opt) Resource Report Resource Website 10+ mentions |
RRID:Addgene_31476 | SFFV d14 GFP donor EF1s I-SceI | Ampicillin | PMID:21743461 | Backbone Size:5092; Vector Backbone:pCVL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | GFP has 14 amino acids deleted from c terminus | 2026-08-15 01:13:35 | 14 | ||
|
pCVL SFFV d14GFP Donor Resource Report Resource Website 10+ mentions |
RRID:Addgene_31475 | SFFV d14GFP | Ampicillin | PMID:21743461 | Backbone Size:5516; Vector Backbone:pCVL; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | Deleted 14 amino acids on the c terminus of eGFP | 2026-08-15 01:13:36 | 11 | ||
|
pSLIK sh human Rb 1534 hyg Resource Report Resource Website 1+ mentions |
RRID:Addgene_31500 | RB shRNA | Homo sapiens | Ampicillin | The whole sequence for the shRNA including the loop should be from 3872-3931 in the vector: AGCGAAACGATTATCCATTCAAATAGTGAAGCCACAGATGTATTTGAAT The shRNA is downstream of the EGFP GGATAATCGTT pSLIK vector from Ian Frasier | Backbone Size:13700; Vector Backbone:pSLIK-EGFP; Vector Types:Mammalian Expression, Lentiviral, RNAi; Bacterial Resistance:Ampicillin | The target sequence for shRB 1534 is GAACGATTATCCATTCAAA | 2026-08-15 01:13:35 | 3 | |
|
pQStrep2-ARPC3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31580 | Actin related protein 2/3 complex, subunit 3 | Homo sapiens | Ampicillin | PMID:15998469 | The vector pQTEV is derived from Qiagen pQE-2 and contains an inactive chloramphenicol resistance gene sequence. Please note that Addgene's quality control sequence shows a small deletion in the vector region downstream of insert; the deletion does not affect any features in this construct. | Backbone Size:3460; Vector Backbone:pQStrep2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:33 | 1 | |
|
pLS1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31490 | lactose repressor protein | Ampicillin | PMID:11266612 | Parent plasmid was pEMBL9' with insert of extended LacI sequence from pIQ (Hare & Sadler, Gene 3 (1978) 269-278. For expression: E. coli BLIM cells (or any E. coli WITHOUT lactose repressor in the genome or accompanying plasmid) | Backbone Size:4540; Vector Backbone:pEMBL9'; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 2 | ||
|
pTARA Resource Report Resource Website 1+ mentions |
RRID:Addgene_31491 | RNA polymerase | T7 phage | Chloramphenicol | PMID:10610690 | For expression: E. coli CV2 N823D mutation should not affect plasmid function. | Backbone Size:5400; Vector Backbone:pBAD33; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol | N823D | 2026-08-15 01:13:33 | 5 |
|
GFP-Rab5 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31733 | Rab5 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:36 | 9 | ||
|
GFP-Rab8 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31735 | Rab8 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:39 | 3 | ||
|
GFP-Rab6 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31734 | Rab6 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | ||
|
GFP-Rab10 Resource Report Resource Website 1+ mentions |
RRID:Addgene_31737 | Rab10 | Drosophila melanogaster | Ampicillin | PMID:21169635 | Backbone Marker:Drosophila Gateway Collection; Vector Backbone:pAGW; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | ||
|
pRK5F-ALK5-HA(ecto) Resource Report Resource Website 1+ mentions |
RRID:Addgene_31720 | ALK5 | Homo sapiens | Ampicillin | This construct is beginning from a Signal Peptide of human TbRI/ALK5, followed by a HA tag, the extracellular cDNA sequence of human TbRI/ALK, and ended by a Flag tag. This vector to produces a secreted TbRI/ALK5 extracellular form, with two individual tags on each side. | Backbone Size:4716; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:36 | 1 | ||
|
LZRS-Rfa Resource Report Resource Website 1+ mentions |
RRID:Addgene_31601 | Chloramphenicol and Ampicillin | PMID:15342384 | Backbone Marker:Khavari Lab; Backbone Size:11100; Vector Backbone:LZRS-RfA; Vector Types:Retroviral; Bacterial Resistance:Chloramphenicol and Ampicillin | 2026-08-15 01:13:37 | 5 | ||||
|
BoNT/A-LC Resource Report Resource Website 1+ mentions |
RRID:Addgene_31602 | BoNT/A LC | Ampicillin | PMID:18940613 | The author states that although the construct is from a toxic protein, it only contains one third of the biologically active protein,i.e., it is inactive and harmless per se, and it does not require BL4 level for its expression/manipulation. Toxic BoNT/A is made of two 'chains' (i.e. polypeptides) linked to each other by one disulfide bond. The light chain (LC) is 50KDa long, whereas the heavy chain (HC) is 100 KDa. The HC is necessary for the toxin to target and enter motorneurons. This construct is the LC of BoNTA, and it completely lacks the HC, so it is unable to intoxicate neurons. Protein sequence of BoNT/A fragment present in this plasmid (corresponds to YP_001386738.1) MSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT Nucleotide sequence of BoNT/A fragment present in this plasmid based on Addgene's Sanger sequencing results: ATGAGTGGGTTAGAAGTAAGCTTTGAGGAACTTAGAACATTTGGGGGACATGATGCAAAGTTTATAGATAGTTTACAGGAAAACGAATTTCGTCTATATTATTATAATAAGTTTAAAGATATAGCAAGTACACTTAATAAAGCTAAATCAATAGTAGGTACTACTGCTTCATTACAGTATATGAAAAATGTTTTTAAAGAGAAATATCTCCTATCTGAAGATACATCTGGAAAATTTTCGGTAGATAAATTAAAATTTGATAAGTTATACAAAATGTTAACAGAGATTTACACAGAGGATAATTTTGTTAAGTTTTTTAAAGTACTTAACAGAAAAACATATTTGAATTTTGATAAAGCCGTATTTAAGATAAATATAGTACCTAAGGTAAATTACACAATATATGATGGATTTAATTTAAGAAATACAAATTTAGCAGCAAACTTTAATGGTCAAAATACAGAAATTAATAATATGAATTTTACTAAACTAAAAAATTTTACT | Backbone Size:0; Vector Backbone:pBN3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:35 | 1 | ||
|
pDONR223-MCU Resource Report Resource Website 1+ mentions |
RRID:Addgene_31726 | MCU | Homo sapiens | Spectinomycin | PMID:21685886 | *A3T aa residue substitution in MCU, which is not known to affect protein function | Backbone Marker:Invitrogen; Backbone Size:2787; Vector Backbone:pDONR223; Vector Types:pDONR Gateway; Bacterial Resistance:Spectinomycin | * | 2026-08-15 01:13:39 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
