Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: G3BP2
Vector Backbone Description: Vector Backbone:pSpCas9(BB)-2A-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136060 Copy
Species: Homo sapiens
Genetic Insert: G3BP2
Vector Backbone Description: Vector Backbone:pSpCas9(BB)-2A-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136061 Copy
Species: Homo sapiens
Genetic Insert: G3BP1
Vector Backbone Description: Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136008 Copy
Species: Homo sapiens
Genetic Insert: G3BP1
Vector Backbone Description: Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136009 Copy
Species: Homo sapiens
Genetic Insert: ZC3H15 3'UTR (Reverse Complement)
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136019 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136021 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136023 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136024 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136027 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 5
Vector Backbone Description: Backbone Marker:BD Biosciences; Backbone Size:4700; Vector Backbone:EGFP-N3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.
Proper citation: RRID:Addgene_13603 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136030 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136033 Copy
Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136034 Copy
Species: Homo sapiens
Genetic Insert: UPF1
Vector Backbone Description: Vector Backbone:PLKO.1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897
Proper citation: RRID:Addgene_136036 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 5
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites.
Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.
Proper citation: RRID:Addgene_13608 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 2
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites.
Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.
Proper citation: RRID:Addgene_13606 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites.
An ITGA5 signal peptide sequence (MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLVPPPPRVGG) is present immediately before the start of ITGA9 at amino acid 30.
Proper citation: RRID:Addgene_13604 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites.
Proper citation: RRID:Addgene_13605 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9 DM3
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pWZL Blast2; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction enzyme sites.
Please see Young et al. (2001), MBC 12:3214 for information regarding which amino acids are removed in this deletion construct.
Proper citation: RRID:Addgene_13613 Copy
Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 2
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pWZL Blast2; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction enzyme sites.
Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.
Proper citation: RRID:Addgene_13610 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.