Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
On page 320 showing 6381 ~ 6400 out of 69,655 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

    • RRID:Addgene_136060

    This resource has 1+ mentions.

http://www.addgene.org/136060

Species: Homo sapiens
Genetic Insert: G3BP2
Vector Backbone Description: Vector Backbone:pSpCas9(BB)-2A-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136060 Copy   

    • RRID:Addgene_136061

    This resource has 1+ mentions.

http://www.addgene.org/136061

Species: Homo sapiens
Genetic Insert: G3BP2
Vector Backbone Description: Vector Backbone:pSpCas9(BB)-2A-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136061 Copy   

    • RRID:Addgene_136008

    This resource has 1+ mentions.

http://www.addgene.org/136008

Species: Homo sapiens
Genetic Insert: G3BP1
Vector Backbone Description: Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136008 Copy   

http://www.addgene.org/136009

Species: Homo sapiens
Genetic Insert: G3BP1
Vector Backbone Description: Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136009 Copy   

http://www.addgene.org/136019

Species: Homo sapiens
Genetic Insert: ZC3H15 3'UTR (Reverse Complement)
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136019 Copy   

    • RRID:Addgene_136021

    This resource has 1+ mentions.

http://www.addgene.org/136021

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136021 Copy   

    • RRID:Addgene_136023

    This resource has 1+ mentions.

http://www.addgene.org/136023

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136023 Copy   

    • RRID:Addgene_136024

    This resource has 1+ mentions.

http://www.addgene.org/136024

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136024 Copy   

    • RRID:Addgene_136027

    This resource has 1+ mentions.

http://www.addgene.org/136027

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136027 Copy   

http://www.addgene.org/13603

Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 5
Vector Backbone Description: Backbone Marker:BD Biosciences; Backbone Size:4700; Vector Backbone:EGFP-N3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.

Proper citation: RRID:Addgene_13603 Copy   

http://www.addgene.org/136030

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136030 Copy   

http://www.addgene.org/136033

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136033 Copy   

http://www.addgene.org/136034

Species: Homo sapiens
Genetic Insert: EIF3B 3'UTR
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136034 Copy   

    • RRID:Addgene_136036

    This resource has 1+ mentions.

http://www.addgene.org/136036

Species: Homo sapiens
Genetic Insert: UPF1
Vector Backbone Description: Vector Backbone:PLKO.1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32017897

Proper citation: RRID:Addgene_136036 Copy   

http://www.addgene.org/13608

Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 5
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites. Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.

Proper citation: RRID:Addgene_13608 Copy   

http://www.addgene.org/13606

Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 2
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites. Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.

Proper citation: RRID:Addgene_13606 Copy   

http://www.addgene.org/13604

Species: Homo sapiens
Genetic Insert: integrin alpha 9
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites. An ITGA5 signal peptide sequence (MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLVPPPPRVGG) is present immediately before the start of ITGA9 at amino acid 30.

Proper citation: RRID:Addgene_13604 Copy   

http://www.addgene.org/13605

Species: Homo sapiens
Genetic Insert: integrin alpha 9
Vector Backbone Description: Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction sites.

Proper citation: RRID:Addgene_13605 Copy   

http://www.addgene.org/13613

Species: Homo sapiens
Genetic Insert: integrin alpha 9 DM3
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pWZL Blast2; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction enzyme sites. Please see Young et al. (2001), MBC 12:3214 for information regarding which amino acids are removed in this deletion construct.

Proper citation: RRID:Addgene_13613 Copy   

http://www.addgene.org/13610

Species: Homo sapiens
Genetic Insert: integrin alpha 9 / alpha 2
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pWZL Blast2; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Comments: See author's map for additional restriction enzyme sites. Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera.

Proper citation: RRID:Addgene_13610 Copy   

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch