Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pSpCas9(BB)-2A-GFP-G3BP2(1) Resource Report Resource Website 1+ mentions |
RRID:Addgene_136060 | G3BP2 | Homo sapiens | Ampicillin | PMID:32017897 | Vector Backbone:pSpCas9(BB)-2A-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:02 | 1 | ||
|
pSpCas9(BB)-2A-GFP-G3BP2(2) Resource Report Resource Website 1+ mentions |
RRID:Addgene_136061 | G3BP2 | Homo sapiens | Ampicillin | PMID:32017897 | Vector Backbone:pSpCas9(BB)-2A-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:01 | 1 | ||
|
pCI-neo-His-MS2BP-G3BP1-WT Resource Report Resource Website 1+ mentions |
RRID:Addgene_136008 | G3BP1 | Homo sapiens | Kanamycin | PMID:32017897 | Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:06:01 | 1 | ||
|
pCI-neo-His-MS2BP-G3BP1-S149A Resource Report Resource Website 1+ mentions |
RRID:Addgene_136009 | G3BP1 | Homo sapiens | Kanamycin | PMID:32017897 | Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | S149A | 2026-08-15 01:06:00 | 1 | |
|
psiCHECK3-ZC3H15-Reverse-Complement Resource Report Resource Website 1+ mentions |
RRID:Addgene_136019 | ZC3H15 3'UTR (Reverse Complement) | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:00 | 1 | ||
|
psiCHECK3-EIF3B-148-464 Resource Report Resource Website 1+ mentions |
RRID:Addgene_136021 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:00 | 1 | ||
|
psiCHECK3-EIF3B-1-464 Resource Report Resource Website 1+ mentions |
RRID:Addgene_136023 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:00 | 1 | ||
|
psiCHECK3-EIF3B-148-552 Resource Report Resource Website 1+ mentions |
RRID:Addgene_136024 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:00 | 1 | ||
|
psiCHECK3-Unstructured-EIF3B Resource Report Resource Website 1+ mentions |
RRID:Addgene_136027 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:00 | 1 | ||
|
integrin alpha9 / alpha5 EGFP-N3 Resource Report Resource Website |
RRID:Addgene_13603 | integrin alpha 9 / alpha 5 | Homo sapiens | Kanamycin | Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera. | Backbone Marker:BD Biosciences; Backbone Size:4700; Vector Backbone:EGFP-N3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Integrin alpha 9 chimera containing the cytoplasmic domain of integrin alpha 5 | 2026-08-15 01:06:00 | 0 | |
|
psiCHECK3-EIF3B-88nt-Delta-Hairpin Resource Report Resource Website 1+ mentions |
RRID:Addgene_136030 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:02 | 1 | ||
|
psiCHECK3-EIF3B-88nt-Restored-Hairpin Resource Report Resource Website 1+ mentions |
RRID:Addgene_136033 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:02 | 1 | ||
|
psiCHECK3-EIF3B-88nt-A:U-Hairpin Resource Report Resource Website 1+ mentions |
RRID:Addgene_136034 | EIF3B 3'UTR | Homo sapiens | Ampicillin | PMID:32017897 | Backbone Marker:Promega; Vector Backbone:Modified psCHECK2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:00 | 1 | ||
|
PLKO.1-UPF1-3'UTR Resource Report Resource Website 1+ mentions |
RRID:Addgene_136036 | UPF1 | Homo sapiens | Ampicillin | PMID:32017897 | Vector Backbone:PLKO.1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:02 | 2 | ||
|
integrin alpha9 / alpha5 EGFP pBabe puro Resource Report Resource Website |
RRID:Addgene_13608 | integrin alpha 9 / alpha 5 | Homo sapiens | Ampicillin | See author's map for additional restriction sites. Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera. | Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | Integrin alpha 9 chimera containing the cytoplasmic domain of integrin alpha 5 | 2026-08-15 01:06:01 | 0 | |
|
integrin alpha9 / alpha2 EGFP pBabe puro Resource Report Resource Website |
RRID:Addgene_13606 | integrin alpha 9 / alpha 2 | Homo sapiens | Ampicillin | See author's map for additional restriction sites. Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera. | Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | Integrin alpha 9 chimera containing the cytoplasmic domain of integrin alpha 2 | 2026-08-15 01:06:01 | 0 | |
|
integrin alpha9 pBabe puro Resource Report Resource Website |
RRID:Addgene_13604 | integrin alpha 9 | Homo sapiens | Ampicillin | See author's map for additional restriction sites. An ITGA5 signal peptide sequence (MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLVPPPPRVGG) is present immediately before the start of ITGA9 at amino acid 30. | Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | contains mature ITGA9 (aa30-1035 compared to NP_002198.2) | 2026-08-15 01:06:01 | 0 | |
|
integrin alpha9 EGFP pBabe puro Resource Report Resource Website |
RRID:Addgene_13605 | integrin alpha 9 | Homo sapiens | Ampicillin | See author's map for additional restriction sites. | Backbone Marker:Available at Addgene (plasmid #1764); Backbone Size:5169; Vector Backbone:pBabe puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:06:02 | 0 | ||
|
integrin alpha9 DM3 pWZL Blast2 Resource Report Resource Website |
RRID:Addgene_13613 | integrin alpha 9 DM3 | Homo sapiens | Ampicillin | See author's map for additional restriction enzyme sites. Please see Young et al. (2001), MBC 12:3214 for information regarding which amino acids are removed in this deletion construct. | Backbone Size:6000; Vector Backbone:pWZL Blast2; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | C-terminal deletion mutant missing the last 22 amino acids in the cytoplasmic domain. | 2026-08-15 01:06:03 | 0 | |
|
integrin alpha9 / alpha2 pWZL Blast2 Resource Report Resource Website |
RRID:Addgene_13610 | integrin alpha 9 / alpha 2 | Homo sapiens | Ampicillin | See author's map for additional restriction enzyme sites. Please see Young et al. (2001), MBC 12:3214 for more information regarding the construction of this chimera. | Backbone Size:6000; Vector Backbone:pWZL Blast2; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | Integrin alpha 9 chimera containing the cytoplasmic domain of integrin alpha 2 | 2026-08-15 01:06:03 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
